GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-21 05:22:59, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_016547653             427 bp    mRNA    linear   VRT 03-MAY-2016
DEFINITION  PREDICTED: Sinocyclocheilus rhinocerous testis- and ovary-specific
            PAZ domain-containing protein 1-like (LOC107736171), partial mRNA.
ACCESSION   XM_016547653
VERSION     XM_016547653.1
DBLINK      BioProject: PRJNA319352
KEYWORDS    RefSeq.
SOURCE      Sinocyclocheilus rhinocerous
  ORGANISM  Sinocyclocheilus rhinocerous
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Cyprinidae; Cyprininae; Sinocyclocheilus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_015782780.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Sinocyclocheilus rhinocerous
                                           Annotation Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..427
                     /organism="Sinocyclocheilus rhinocerous"
                     /mol_type="mRNA"
                     /isolate="Xijiao"
                     /db_xref="taxon:307959"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="muscle"
                     /dev_stage="adult"
                     /geo_loc_name="China: Luoping, Yunnan"
                     /collection_date="2012-08-20"
                     /note="semi-cave-dwelling"
     gene            1..>427
                     /gene="LOC107736171"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 6 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:107736171"
     CDS             34..>427
                     /gene="LOC107736171"
                     /codon_start=1
                     /product="testis- and ovary-specific PAZ domain-containing
                     protein 1-like"
                     /protein_id="XP_016403139.1"
                     /db_xref="GeneID:107736171"
                     /translation="
MIKTILGRIGVSLIFRYHRTRDWNKGVKLVSVMFRLHIEFITLKGLMGNENRVSRCQLVTMATEFFLHSGSFEGALKMLRADGWFVSSSMWPCEQADIENRKHVLTLLAGKTSHRDAFEIITNLPGIRQPI"
     misc_feature    <40..354
                     /gene="LOC107736171"
                     /note="Putative aspartate racemase; Region:
                     Asp_Glu_race_2; pfam14669"
                     /db_xref="CDD:464250"
ORIGIN      
ctgtcagtatgtcagcaagtcttgtccaatgacatgataaaaaccatcctggggagaattggagtctctctgatcttcaggtaccacaggacacgagattggaataagggagtgaagctggttagtgtgatgttcagactgcacattgagttcatcactctgaaagggcttatggggaatgagaacagggtgtctcgctgtcagctggtcactatggcaacggagttcttcctccatagcgggagctttgagggagctttgaaaatgctgagagctgatggctggtttgtgagctccagcatgtggccttgtgagcaggctgacatcgaaaatcgaaaacatgtcctgacgctcttagctgggaagacgtcacacagggacgcctttgagattattaccaatttacctggaatcagacaaccgataa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]