2025-04-20 18:38:23, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_014946083 1360 bp mRNA linear VRT 09-DEC-2015 DEFINITION PREDICTED: Calidris pugnax VCP-interacting membrane selenoprotein (VIMP), mRNA. ACCESSION XM_014946083 VERSION XM_014946083.1 DBLINK BioProject: PRJNA305421 KEYWORDS RefSeq. SOURCE Calidris pugnax (ruff) ORGANISM Calidris pugnax Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Neoaves; Charadriiformes; Scolopacidae; Calidris. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_015090873.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Calidris pugnax Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1360 /organism="Calidris pugnax" /mol_type="mRNA" /isolate="Ruff" /db_xref="taxon:198806" /chromosome="Unknown" gene 1..1360 /gene="VIMP" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 9 samples with support for all annotated introns" /db_xref="GeneID:106890328" CDS 33..608 /gene="VIMP" /codon_start=1 /product="selenoprotein S" /protein_id="XP_014801569.1" /db_xref="GeneID:106890328" /translation="
MELGGGEAAAGPGQAALGQGGLEVLQHTVGSLLSSYGWYILLAAVAIYLLMQKVSQGLAARQSAQAGAADAAVEPDVVVRRQEALAAARLRMQEELNAQAERYKEKQRQLEEEKRRQKIAMWESMQEGKSYKGNLKLSQQEVESGASTSSAVPKSKPNKKPLRGGGYNPLSGEGGGTCSWRPGRRGPSAGG"
misc_feature 33..605 /gene="VIMP" /note="Selenoprotein S (SelS); Region: Selenoprotein_S; pfam06936" /db_xref="CDD:462043" ORIGIN
tggacgtgaggcggcagcggcggcggcgggcgatggagctggggggcggcgaggccgcggcgggcccggggcaggcggcgctgggccagggcggcctggaggtcctgcagcacacggtgggctccctgctgtccagttatggctggtacatcctcctggccgctgtcgccatctatctcctcatgcagaaggtctcgcaggggctggcggcccggcagagcgcccaggcgggagcagctgacgcagctgtggaacccgatgtggtggtgagaaggcaggaagccttggcagcagctcgcctcaggatgcaagaggagttgaatgcacaagcagaaagatacaaagaaaagcaaagacagcttgaagaagagaaacgaaggcagaagatagcaatgtgggaaagtatgcaagaaggaaaaagctataaaggaaacctgaaactgagtcagcaagaagtagaatctggtgcctccacctcatcagcagtcccgaaatctaaaccaaacaaaaagcccttgcgaggaggtggctataaccccctctctggagaaggaggtggaacttgttcctggagacccggccggagaggcccatcagcaggtggatgaggctaaagcctccctagtgtctggtgtcactagggcttgttcttacccactgtctaactgcctacagtttgcgtgtcacagcgactcctttgggatggggcttagtgcaggtgttaacttgaaaacagatttacaccatttccacatagtaatgcagaagctgataactacgcaagaaaaatagccagtcctctccgagaggatgaagaagaaacaatttcagtgtaatcagttcattttcactctcctgtagaggagaagcgtagtctccagccaaggtgaatcacctgggattgggagatctggtttctggggctggctattcaaaaagactggcctcgggcacatttaattatctctgctccgtttatttctgtaaaacgaggatacttgccctcctcagacatgtgtcaccagatttactgtgtttggctggaaggtacttcagagggaaagaataatatcatcggcaggagccttgaattttaggaggagggactttcagaaaaaaaacagatgaactgacagacgccacggatttgaaccacaggtcagttactgcagaagagtctctgtgacaagctaccttgaatgatgttttccttataaatggtaaacaaaccagtgaggattactgatgctagacagcagatagggggtttcttgctattccttttttttttttttatttcaaccgctttgtaaaaacaaaacactattaatattaaatataattgcaaagaaatcataaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]