2025-10-16 05:25:53, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_014251223 676 bp mRNA linear VRT 21-SEP-2015 DEFINITION PREDICTED: Pseudopodoces humilis VCP-interacting membrane selenoprotein (VIMP), transcript variant X2, mRNA. ACCESSION XM_014251223 VERSION XM_014251223.1 DBLINK BioProject: PRJNA217046 KEYWORDS RefSeq. SOURCE Pseudopodoces humilis (Tibetan ground-tit) ORGANISM Pseudopodoces humilis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Neoaves; Telluraves; Australaves; Passeriformes; Paridae; Pseudopodoces. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_005087564.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Pseudopodoces humilis Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..676 /organism="Pseudopodoces humilis" /mol_type="mRNA" /db_xref="taxon:181119" /chromosome="Unknown" gene 1..676 /gene="VIMP" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:102106040" CDS 14..571 /gene="VIMP" /codon_start=1 /product="selenoprotein S isoform X2" /protein_id="XP_014106698.1" /db_xref="GeneID:102106040" /translation="
MEPGGDGPAAGPGPALGRGGLEALQHTAGSVLSSYGWYMLLAVVAVYLLVQKVSRSLASRPSGRPGAAEAAEEPDAVVRRQEALAAARLRMQEELNAQAERYKEKQRQLEEERRRQKIAMWESMQEGKSYKGNLKLNQQEVESGASASAVPKSKPNKKPLRGGDYSLQDWNKGLSPWLLGLLENR"
misc_feature 71..511 /gene="VIMP" /note="Selenoprotein S (SelS); Region: Selenoprotein_S; pfam06936" /db_xref="CDD:462043" ORIGIN
tcggcggcgggtgatggagcccgggggtgacggtcccgcggcagggcccgggccggcgctgggccggggcggcctggaggccctgcagcacacggcgggctcggtgctgtccagctatggctggtacatgctcctggccgtcgtcgccgtgtatcttctcgtgcagaaggtgtcccgcagcctggcgtcgcggccgagcggccggcccggagcagctgaggcggccgaggaacctgatgcagtggtgagaaggcaggaagctttggcagcagctcgcctcaggatgcaagaggaattgaatgcacaagcagaaagatacaaggaaaagcaaagacagctggaggaggagaggcgaaggcagaagatcgcgatgtgggagagtatgcaagaaggaaaaagctacaaaggaaacctgaaactgaatcagcaagaagtagaatctggtgcctctgcctcagcagtcccaaaatctaaaccaaacaaaaagcctttgagaggaggtgactactccttgcaggactggaataagggattaagtccctggctgttggggctcttggagaacagataacactctacagagtttactgctataacccactgtctggagaaggaggagggacgtgctcctggagacccggccggcggggcccgtcagcaggtggatgaggctaac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]