LOCUS       NM_022175                794 bp    mRNA    linear   ROD 30-MAR-2024
DEFINITION  Rattus norvegicus Rhox homeobox family member 5 (Rhox5), mRNA.
ACCESSION   NM_022175 XM_039099478
VERSION     NM_022175.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 794)
  AUTHORS   MacLean,J.A. 2nd, Hayashi,K., Turner,T.T. and Wilkinson,M.F.
  TITLE     The Rhox5 homeobox gene regulates the region-specific expression of
            its paralogs in the rodent epididymis
  JOURNAL   Biol Reprod 86 (6), 189 (2012)
   PUBMED   22423045
  REMARK    GeneRIF: regulates the expression of other Rhox genes in the
            epididymis
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 794)
  AUTHORS   Bhardwaj,A., Song,H.W., Beildeck,M., Kerkhofs,S., Castoro,R.,
            Shanker,S., De Gendt,K., Suzuki,K., Claessens,F., Issa,J.P.,
            Orgebin-Crist,M.C. and Wilkinson,M.F.
  TITLE     DNA demethylation-dependent AR recruitment and GATA factors drive
            Rhox5 homeobox gene transcription in the epididymis
  JOURNAL   Mol Endocrinol 26 (4), 538-549 (2012)
   PUBMED   22322598
  REMARK    GeneRIF: GATA factors collaborate to dictate the unique
            developmental and region-specific expression pattern of the RHOX5
            homeobox transcription factor in the caput epididymis.
REFERENCE   3  (bases 1 to 794)
  AUTHORS   MacLean,J.A. 2nd, Rao,M.K., Doyle,K.M., Richards,J.S. and
            Wilkinson,M.F.
  TITLE     Regulation of the Rhox5 homeobox gene in primary granulosa cells:
            preovulatory expression and dependence on SP1/SP3 and GABP
  JOURNAL   Biol Reprod 73 (6), 1126-1134 (2005)
   PUBMED   16093360
  REMARK    GeneRIF: expression in the ovary is governed by the distal promoter
            and is expressed at least as early as Day 5 postpartum. mRNA levels
            are regulated during the ovarian cycle, peaking before ovulation
REFERENCE   4  (bases 1 to 794)
  AUTHORS   Rao,M.K., Maiti,S., Ananthaswamy,H.N. and Wilkinson,M.F.
  TITLE     A highly active homeobox gene promoter regulated by Ets and Sp1
            family members in normal granulosa cells and diverse tumor cell
            types
  JOURNAL   J Biol Chem 277 (29), 26036-26045 (2002)
   PUBMED   11986330
  REMARK    GeneRIF: Pem promoter may be a useful model system to understand
            the molecular mechanism by which a tissue-specific promoter can be
            corrupted in tumor cells
REFERENCE   5  (bases 1 to 794)
  AUTHORS   Maiti,S., Doskow,J., Li,S., Nhim,R.P., Lindsey,J.S. and
            Wilkinson,M.F.
  TITLE     The Pem homeobox gene. Androgen-dependent and -independent
            promoters and tissue-specific alternative RNA splicing
  JOURNAL   J Biol Chem 271 (29), 17536-17546 (1996)
   PUBMED   8663309
REFERENCE   6  (bases 1 to 794)
  AUTHORS   Maiti,S., Doskow,J., Sutton,K., Nhim,R.P., Lawlor,D.A., Levan,K.,
            Lindsey,J.S. and Wilkinson,M.F.
  TITLE     The Pem homeobox gene: rapid evolution of the homeodomain, X
            chromosomal localization, and expression in reproductive tissue
  JOURNAL   Genomics 34 (3), 304-316 (1996)
   PUBMED   8786129
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAXUCZ010000021.1.
            
            On or before May 21, 2021 this sequence version replaced
            XM_039099478.1, NM_022175.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: FQ228987.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760434, SAMN06621351
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on expression
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-32                JAXUCZ010000021.1  121402049-121402080
            33-93               JAXUCZ010000021.1  121403020-121403080
            94-175              JAXUCZ010000021.1  121403724-121403805
            176-527             JAXUCZ010000021.1  121403973-121404324
            528-573             JAXUCZ010000021.1  121404932-121404977
            574-794             JAXUCZ010000021.1  121407423-121407643
FEATURES             Location/Qualifiers
     source          1..794
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="X"
                     /map="Xq35"
     gene            1..794
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /note="Rhox homeobox family member 5"
                     /db_xref="GeneID:24631"
                     /db_xref="RGD:3295"
     exon            1..32
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /inference="alignment:Splign:2.1.0"
     exon            33..93
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    58..60
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /note="upstream in-frame stop codon"
     exon            94..175
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /inference="alignment:Splign:2.1.0"
     CDS             97..723
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /note="homeobox protein Pem; reproductive homeobox on
                     chromosome X 5; placenta and embryonic expression protein;
                     placentae and embryos oncofetal; Homeobox gene Pem;
                     reproductive homeobox 5"
                     /codon_start=1
                     /product="homeobox protein Rhox5"
                     /protein_id="NP_071511.2"
                     /db_xref="GeneID:24631"
                     /db_xref="RGD:3295"
                     /translation="

MEAQGSSHDISRLLCLGVKEDSEEQHDVKAEAFFQAGEGRDEKGAQGQPGEGAVGTEGEGEELNGGEGHFGPGVPGPVGEGDKDGGTRASGMEEEQHEPVAEGTESVKSEDKQMPLRRPGSTQRRLAELERILLSSGSSSGPTWEELDRWMDISVSRVQNWFKIRRAAYRRNRRRRTPIPEHFRATSGCPACLGARWGVRCPFATPRF"

     exon            176..527
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /inference="alignment:Splign:2.1.0"
     exon            528..573
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /inference="alignment:Splign:2.1.0"
     exon            574..794
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atattttggagagagaaaagccaagcagccatccttcaagatcacctcctgtattcctagctggacaagaggaaacacaaagagaaccatccagatatggaggctcaaggctctagccatgatatcagccgcttactctgcctgggagtcaaggaagactcggaagaacagcatgatgtgaaagcagaggctttctttcaggctggagaggggagagacgagaaaggtgcacagggtcagcctggagagggagcagtgggaacagaaggcgaaggagaagaattaaatggaggagaaggccactttggtcctggtgttccaggtcctgtgggtgagggggacaaggatggtggcaccagagctagtggcatggaggaggagcaacatgagcccgttgccgagggcactgagagtgtcaagtctgaggataagcagatgccactccgccgccctgggtccacccagcggcggctggcggaattggagcgcattttgctaagcagtggttcctccagtggcccaacatgggaggagcttgatagatggatggatatcagtgtgtccagagtgcagaattggtttaagattaggagggctgcatacagaagaaataggaggcggagaacaccaatccctgaacattttagagcaacatctgggtgccctgcttgtcttggagcaagatggggagtaagatgtccttttgcaacaccgagattttgatcacatatgccagccatgacaactcttgcctttcaacaattctgtcagcaataaagaaatgattctcagta

//