2025-10-16 18:11:40, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001110144 663 bp mRNA linear ROD 02-APR-2025 DEFINITION Rattus norvegicus claudin 24 (Cldn24), mRNA. ACCESSION NM_001110144 XM_001059310 XM_577519 VERSION NM_001110144.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 663) AUTHORS Mineta,K., Yamamoto,Y., Yamazaki,Y., Tanaka,H., Tada,Y., Saito,K., Tamura,A., Igarashi,M., Endo,T., Takeuchi,K. and Tsukita,S. TITLE Predicted expansion of the claudin multigene family JOURNAL FEBS Lett 585 (4), 606-612 (2011) PUBMED 21276448 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH473995.2. On or before Oct 26, 2007 this sequence version replaced XM_577519.1, XM_001059310.1. ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..663 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="16" /map="16q11" gene 1..663 /gene="Cldn24" /gene_synonym="RGD1562043" /note="claudin 24" /db_xref="GeneID:502083" /db_xref="RGD:1562043" CDS 1..663 /gene="Cldn24" /gene_synonym="RGD1562043" /note="claudin 22 like" /codon_start=1 /product="putative claudin-24" /protein_id="NP_001103614.1" /db_xref="GeneID:502083" /db_xref="RGD:1562043" /translation="
MAFIFKTAMQSVALSLSLLGWVLAITTTYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQISRILMSLSNGLGLLGLLASGCGLDCLRLGETRKGLKRRLLILGGTLLWTSGVMVLVPVSWVAHMTVQEFWDETVPEIVPRWEFGEALFLGWFAGLCLVLGGCVLHCAACWRPAPPASGHYAVAGLGDHSSYLENGTAQPKV"
misc_feature 19..540 /gene="Cldn24" /gene_synonym="RGD1562043" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" exon 1..663 /gene="Cldn24" /gene_synonym="RGD1562043" /inference="alignment:Splign:2.1.0" ORIGIN
atggctttcatcttcaaaacggccatgcaatcggtcgcgctttctctgtcattgctgggatgggttctagccattactaccacgtatctgccacactggaagaacctcaacctggagctgaacgagatggaaaactggaccatggggctctggaaatcctgcgtcatccaggaggaggtcgggaggcaatgcaaggactttgactccttcctggccttgccagctgaactgcagatctccaggatcctgatgtccctgtccaatgggctggggctgctgggcttgctggcctctggctgtggcctggactgtctgaggctcggagagacccggaagggtctgaagaggcgactgctcatcctgggagggaccctgctctggacctctggtgtgatggtcctggttcctgtctcctgggtggcccacatgacagtgcaagagttctgggatgagactgtacctgagattgtgcccaggtgggagttcggggaggccctgttcctgggctggtttgctggtctctgcctggtgcttggaggatgtgtgcttcactgtgcagcctgctggaggccggctcctccagcctcgggccactatgcagtggcgggacttggagaccacagttcatacctggaaaatggaactgcacagcctaaagtgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]