ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-09-24 09:45:52, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_002937792 877 bp mRNA linear VRT 18-DEC-2019
DEFINITION PREDICTED: Xenopus tropicalis EEF1A lysine methyltransferase 2
(eef1akmt2), transcript variant X2, mRNA.
ACCESSION XM_002937792
VERSION XM_002937792.5
DBLINK BioProject: PRJNA205740
KEYWORDS RefSeq.
SOURCE Xenopus tropicalis (tropical clawed frog)
ORGANISM Xenopus tropicalis
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
Xenopus; Silurana.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_030683.2) annotated using gene prediction method: Gnomon,
supported by EST evidence.
Also see:
Documentation of NCBI's Annotation Process
On Dec 18, 2019 this sequence version replaced XM_002937792.4.
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Name :: Xenopus tropicalis Annotation
Release 104
Annotation Version :: 104
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 8.3
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..877
/organism="Xenopus tropicalis"
/mol_type="mRNA"
/strain="Nigerian"
/db_xref="taxon:8364"
/chromosome="7"
/sex="female"
/tissue_type="liver and blood"
/dev_stage="adult"
/note="F17 inbred"
gene 1..877
/gene="eef1akmt2"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 12 ESTs, 7 Proteins, and 100%
coverage of the annotated genomic feature by RNAseq
alignments, including 111 samples with support for all
annotated introns"
/db_xref="GeneID:100498530"
/db_xref="Xenbase:XB-GENE-1005689"
CDS 126..788
/gene="eef1akmt2"
/codon_start=1
/product="EEF1A lysine methyltransferase 2 isoform X2"
/protein_id="XP_002937838.1"
/db_xref="GeneID:100498530"
/db_xref="Xenbase:XB-GENE-1005689"
/translation="
MTNEEEFSPSALGTKAHWDAVYSRELQSFKEYGDEGEIWFGEGSMARVIRWLNAHKVPQTASILDIGTGNGMLLVELAKSGYCNLTGIDYSSDAVELAKSICEKEGVSQNAQLQVTDFLEDFHPSQQFDVCLDKGTFDAVSLDPTGATEKREQYVRSLCQALKAQGLFIITSCNWTKEELLSQFGEEFEFKDELPTPTFSFGGKAGHSVTALVLQRRNHS"
misc_feature 276..>641
/gene="eef1akmt2"
/note="SAM-dependent methyltransferase [Secondary
metabolites biosynthesis, transport and catabolism,
General function prediction only]; Region: SmtA; COG0500"
/db_xref="CDD:440266"
ORIGIN
cctgtgctgacatcacctttagcgcctggatacccagcatgctttgcgtggcatgacgtgggaaagacgagacagccggtgttggcttcactttttcatattcggtctcatttccacccggtaacatgaccaatgaggaagaattttcgccgtcagcactgggtaccaaggcacactgggatgctgtttatagtcgagagcttcagtcatttaaggaatacggtgatgagggtgaaatatggttcggagaaggcagtatggcaagagttatccgatggctaaatgcacacaaagtaccacagactgcttccatacttgacattggaacaggaaatggcatgttactggtggaactggcaaagtctggctactgcaatctcactggcatagattatagcagtgatgctgtggaactagcgaaaagcatatgtgaaaaggagggggtctcccaaaatgcacagttgcaggtcacagattttcttgaagacttccatccatcacagcagtttgacgtttgcttggataaaggaacatttgacgcagtgagcttagatccgacaggtgcaacagagaagcgtgagcagtatgtgcggtcgctatgccaggccctaaaggcgcaggggctttttattataacttcctgcaactggaccaaggaggaactacttagtcagtttggggaagagtttgaattcaaggatgagcttccaacacccacatttagttttggaggcaaggcaggtcacagcgttactgcattggtattacagaggagaaaccactcttgagagacttggcaaaaacagaaaaatgtttatttattcattttttaattatatgcatttatgtattaaatatatttgattataaaaagaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]