GGRNA ver.2 Help | Advanced search | English    旧バージョン

2021-09-21 23:49:39, GGRNA : RefSeq release 206 (May, 2021)

Summary:

Results:

検索語に色がつきます重なると色が濃く表示されます。

Rattus norvegicus homeobox B2 (Hoxb2), mRNA. (1657 bp)
LOCUS NM_001047091 1657 bp mRNA linear ROD 02-OCT-2017 DEFINITION Rattus norvegicus homeobox B2 (Hoxb2), mRNA. ACCESSION NM_001047091 XM_001081296 XM_220894 VERSION NM_001047091.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 608..766 /gene="Hoxb2" /gene_synonym="Hoxbes2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1657) AUTHORS Jolma A, Yan J, Whitington T, Toivonen J,...
Synonym: Hoxbes2
NM_001047091.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus paired related homeobox 2 (Prrx2), mRNA. (1230 bp)
gene="Prrx2" /gene_synonym="Prx2" /codon_start=1 /product="paired mesoderm homeobox protein 2" /protein_id="NP_001099209.1" /db_xref="GeneID:113931" /db_xref="RGD:1311471" /translation="MDSAAAAFALDPPAPGPGPPPAPGDCAQARKNFSVSHLLDLEEVAAAGRRAAGPVPGPEAREGAAREPSGGSSGSEAAPQDGECAAPGHGSATKRKKKQRRNRTTFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLATRSASLLKSYGQEAAIEQPVAPRPTTLSPDYLSWPASSPYSSVPPYSPGGSSPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN" misc_feature 464..622 /gene="Prrx2" /gene_synonym="Prx2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature <482..796 /gene="...
Synonym: Prx2
NM_001105739.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 10-APR-2021 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence version replaced...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus Rhox homeobox family member 5 (Rhox5), mRNA. (636 bp)
organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="X" /map="Xq35" gene 1..636 /gene="Rhox5" /gene_synonym="Pem" /note="Rhox homeobox family member 5" /db_xref="GeneID:24631" /db_xref="RGD:3295" CDS 1..636 /gene="Rhox5" /gene_synonym="Pem" /note="homeobox protein Pem; reproductive homeobox on chromosome X 5; placenta and embryonic expression protein; placentae and embryos oncofetal; Homeobox gene Pem; reproductive homeobox 5" /codon_start=1 /product="homeobox protein Rhox5" /protein_id="NP_071511.1" /db_xref="GeneID:24631" /db_xref="RGD:3295" /translation="...
Synonym: Pem
NM_022175.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus SEBOX homeobox (Sebox), mRNA. (567 bp)
LOCUS NM_023951 567 bp mRNA linear ROD 11-APR-2021 DEFINITION Rattus norvegicus SEBOX homeobox (Sebox), mRNA. ACCESSION NM_023951 VERSION NM_023951.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...Og9x" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 61..216 /gene="Sebox" /gene_synonym="Og9x" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(61..63,70..72,190..192,199..204,211..213) /gene="Sebox" /gene_synonym="Og9x...
Synonym: Og9x
NM_023951.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus reproductive homeobox on X chromosome 3 (Rhox3), mRNA. (908 bp)
LOCUS NM_001135607 908 bp mRNA linear ROD 16-MAR-2021 DEFINITION Rattus norvegicus reproductive homeobox on X chromosome 3 (Rhox3), mRNA. ACCESSION NM_001135607 VERSION NM_001135607.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...Rhox3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 685..843 /gene="Rhox3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 401..764 /gene="Rhox3" /inference="alignment:Splign:2.1.0" exon 765..810 /gene="...
NM_001135607.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box B8 (Hoxb8), mRNA. (973 bp)
gene_synonym="Hox2r1a" /note="Hox2.4 homeobox homolog; homeobox gene B8; homeobox protein R1a" /codon_start=1 /product="homeobox protein Hox-B8" /protein_id="NP_001178578.1" /db_xref="GeneID:24457" /db_xref="RGD:1586211" /translation="MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKEKLERAPETAEQGDAQKGDKK" misc_feature 448..609 /gene="Hoxb8" /gene_synonym="Hox2r1a" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: Hox2r1a
NM_001191649.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus reproductive homeobox 4G (Rhox4g), mRNA. (829 bp)
LOCUS NM_001024889 829 bp mRNA linear ROD 16-MAR-2021 DEFINITION Rattus norvegicus reproductive homeobox 4G (Rhox4g), mRNA. ACCESSION NM_001024889 XM_233314 VERSION NM_001024889.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from DQ058652.1. On Jun 17, 2005 this sequence...
NM_001024889.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box A2 (Hoxa2), mRNA. (1634 bp)
hox-1.11; Hoxa-2; Hoxa11; RATHOX111A" /db_xref="UniSTS:491328" misc_feature 53..55 /gene="Hoxa2" /gene_synonym="hox-1.11; Hoxa-2; Hoxa11; RATHOX111A" /note="upstream in-frame stop codon" CDS 158..1276 /gene="Hoxa2" /gene_synonym="hox-1.11; Hoxa-2; Hoxa11; RATHOX111A" /note="Homeobox gene A11; Homeobox gene A2; homeobox protein Hox-1.11" /codon_start=1 /product="homeobox protein Hox-A2" /protein_id="NP_036713.2" /db_xref="GeneID:103690123" /db_xref="RGD:2813" /translation="...
Synonym: hox-1.11; Hoxa-2; Hoxa11; RATHOX111A
NM_012581.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box A5 (Hoxa5), mRNA. (2938 bp)
review. The reference sequence was derived from JACYVU010000142.1. On Oct 25, 2019 this sequence version replaced XM_003752180.2. Summary: homeobox transcription factor; may be important for pattern specification [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the...Hoxa5" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 2419..2580 /gene="Hoxa5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" exon 2387..2938 /gene="Hoxa5" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1...
NM_024389.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox A7 (Hoxa7), mRNA. (910 bp)
mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="4" /map="4q24" gene 1..910 /gene="Hoxa7" /gene_synonym="Hox1r5; Hoxa9" /note="homeobox A7" /db_xref="GeneID:500126" /db_xref="RGD:1587253" exon 1..476 /gene="Hoxa7" /gene_synonym="Hox1r5; Hoxa9" /inference="alignment:Splign:2.1.0" misc_feature 65..67 /gene="Hoxa7" /gene_synonym="Hox1r5; Hoxa9" /note="upstream in-frame stop codon" CDS 101..790 /gene="Hoxa7" /gene_synonym="Hox1r5; Hoxa9" /note="Homeobox gene A7; hox-1.1; homeobox protein Hox-A7-like; homeobox protein R5; homeobox protein Hox-1.1; homeobox A9" /codon_start=1 /product="...
Synonym: Hox1r5; Hoxa9
NM_001109233.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box D3 (Hoxd3), mRNA. (2527 bp)
synonym="Hox4r6" /inference="alignment:Splign:2.1.0" STS 349..1945 /gene="Hoxd3" /gene_synonym="Hox4r6" /db_xref="UniSTS:491330" misc_feature 376..378 /gene="Hoxd3" /gene_synonym="Hox4r6" /note="upstream in-frame stop codon" CDS 382..1680 /gene="Hoxd3" /gene_synonym="Hox4r6" /note="homeobox protein R6; Homeobox gene D3" /codon_start=1 /product="homeobox protein Hox-D3" /protein_id="NP_001257967.1" /db_xref="GeneID:288152" /db_xref="RGD:1588601" /translation="...
Synonym: Hox4r6
NM_001271038.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ventral anterior homeobox 2 (Vax2), mRNA. (879 bp)
misc_feature 220..303 /gene="Vax2" /note="Region: vax upstream domain" misc_feature 304..483 /gene="Vax2" /note="Region: homeobox" misc_feature order(307..321,325..327,376..378,394..396,433..435, 439..444,451..456,460..468,472..477) /gene="Vax2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 313..474 /gene="Vax2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(313..315,322..324,442..444,451..456,463..465) /gene="Vax2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_...
NM_022637.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ventral anterior homeobox 1 (Vax1), mRNA. (1011 bp)
misc_feature 214..297 /gene="Vax1" /note="Region: vax upstream domain" misc_feature 298..477 /gene="Vax1" /note="Region: homeobox" misc_feature order(301..315,319..321,370..372,388..390,427..429, 433..438,445..450,454..462,466..471) /gene="Vax1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 307..468 /gene="Vax1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(307..309,316..318,436..438,445..450,457..459) /gene="Vax1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_...
NM_022636.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box C4 (Hoxc4), mRNA. (2068 bp)
synonym="Hox3r3" /inference="alignment:Splign:2.1.0" STS 151..1416 /gene="Hoxc4" /gene_synonym="Hox3r3" /db_xref="UniSTS:491379" misc_feature 356..358 /gene="Hoxc4" /gene_synonym="Hox3r3" /note="upstream in-frame stop codon" CDS 428..1222 /gene="Hoxc4" /gene_synonym="Hox3r3" /note="homeobox protein R3; Homeobox gene C4" /codon_start=1 /product="homeobox protein Hox-C4" /protein_id="NP_001103354.1" /db_xref="GeneID:24459" /db_xref="RGD:1586210" /translation="...
Synonym: Hox3r3
NM_001109884.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus Rhox homeobox family member 7 (Rhox7), mRNA. (2802 bp)
LOCUS NM_001393802 2802 bp mRNA linear ROD 12-MAR-2021 DEFINITION Rattus norvegicus Rhox homeobox family member 7 (Rhox7), mRNA. ACCESSION NM_001393802 XM_039099574 VERSION NM_001393802.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000455.1. On Mar 12, 2021...
NM_001393802.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box B7 (Hoxb7), mRNA. (1235 bp)
sequence was derived from BC079340.1. On Apr 29, 2005 this sequence version replaced XM_573181.1. Summary: mouse homolog is a DNA-binding homeobox transcription factor; may play a role in development of the haemopoietic system [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset...base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 440..598 /gene="Hoxb7" /gene_synonym="Hox2r1b; R1b" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 53..122 /gene="Hoxb7" /gene_synonym="Hox2r1b; R1b" /standard_name="Hoxb7" /db_xref="...
Synonym: Hox2r1b; R1b
NM_001017480.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox A6 (Hoxa6), mRNA. (876 bp)
note="upstream in-frame stop codon" CDS 99..800 /gene="Hoxa6" /note="homeobox protein Hox-A6-like" /codon_start=1 /product="homeobox protein Hox-A6" /protein_id="NP_001178016.1" /db_xref="GeneID:685732" /db_xref="RGD:1590236" /translation="MSSYFVNPTFPGSLPSGQDSFLGQLPLYPAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGNSKQRGPGDYLHFSPEQQYKPDSSSVQGKALHEEGTDRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQASGEDSEAKAGE" misc_feature 573..734 /gene="Hoxa6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" STS 106..173 /...
NM_001191087.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus H6 family homeobox 1 (Hmx1), mRNA. (1522 bp)
LOCUS NM_001108363 1522 bp mRNA linear ROD 18-MAR-2021 DEFINITION Rattus norvegicus H6 family homeobox 1 (Hmx1), mRNA. ACCESSION NM_001108363 XM_001064149 XM_341238 VERSION NM_001108363.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000254.1. On Mar...
NM_001108363.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box C10 (Hoxc10), mRNA. (1870 bp)
gene 1..1870 /gene="Hoxc10" /note="homeo box C10" /db_xref="GeneID:315338" /db_xref="RGD:1307250" CDS 1..1029 /gene="Hoxc10" /note="Hox3.5 homeobox" /codon_start=1 /product="homeobox protein Hox-C10" /protein_id="NP_001295565.1" /db_xref="GeneID:315338" /db_xref="RGD:1307250" /translation="...Homeodomain-containing transcription factor [Transcription]; Region: COG5576" /db_xref="CDD:227863" misc_feature 811..975 /gene="Hoxc10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" exon 1..751 /gene="Hoxc10" /inference="alignment:Splign:2.1.0" exon 752..1870 /gene="...
NM_001308636.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus paired related homeobox 1 (Prrx1), mRNA. (1377 bp)
LOCUS NM_153821 1377 bp mRNA linear ROD 21-APR-2021 DEFINITION Rattus norvegicus paired related homeobox 1 (Prrx1), mRNA. ACCESSION NM_153821 VERSION NM_153821.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...propagated from UniProtKB/Swiss-Prot (P63014.1); phosphorylation site" misc_feature 624..782 /gene="Prrx1" /gene_synonym="Pmx1; Prx-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 807..809 /gene="Prrx1" /gene_synonym="Pmx1; Prx-1" /note="N6-acetyllysine. /...
Synonym: Pmx1; Prx-1
NM_153821.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus LIM homeobox 4 (Lhx4), mRNA. (1908 bp)
LOCUS NM_001108348 1908 bp mRNA linear ROD 12-MAR-2021 DEFINITION Rattus norvegicus LIM homeobox 4 (Lhx4), mRNA. ACCESSION NM_001108348 XM_001072440 XM_039090907 XM_341135 VERSION NM_001108348.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from...
NM_001108348.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ladybird homeobox 1 (Lbx1), mRNA. (1164 bp)
LOCUS NM_001047108 1164 bp mRNA linear ROD 09-APR-2021 DEFINITION Rattus norvegicus ladybird homeobox 1 (Lbx1), mRNA. ACCESSION NM_001047108 XM_001058110 XM_574675 VERSION NM_001047108.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 385..546 /gene="Lbx1" /gene_synonym="RGD1564197" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(385..387,394..396,514..516,523..528,535..537) /gene="Lbx1" /gene_synonym="...
Synonym: RGD1564197
NM_001047108.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus gastrulation brain homeobox 2 (Gbx2), mRNA. (1538 bp)
gene="Gbx2" /codon_start=1 /product="homeobox protein GBX-2" /protein_id="NP_446160.1" /db_xref="GeneID:114500" /db_xref="RGD:621866" /translation="MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLALPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQEAAAARKFAPQPLPGGGNFDKSEALQADTEDGKAFLAKEGSLLAFSAAEAVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLPGQTAHKEEDPGHALEETPQSGGAAGSTTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAGNANSKTGEPSRNPKIVVPIPVHVSRFAIRSQHQQLEQARP" misc_feature 786..950 /gene="Gbx2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001"...
NM_053708.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus dorsal root ganglia homeobox (Drgx), mRNA. (2403 bp)
related homeobox protein-like 1; paired-like homeodomain trancription factor Drg11" /codon_start=1 /product="dorsal root ganglia homeobox protein" /protein_id="NP_665710.2" /db_xref="GeneID:252880" /db_xref="RGD:628616" /translation="MFYFHCPPQLEGTAPFGNHSTGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQVWFQNRRAKWRKTERGASDQEPGAKEPMAEVTPPPVRNINSPPPGDQARGKKEALEAQQSLGRTVGPAGPFFPSCLPGTLLNTATYAQALSHVASLKGGPLCSCCVPDPMGLSFLPTYGCQSNRTASVAALRMKAREHSEAVLQSANLLPSTSSSPGPASKQVPPEGSQDKPSPTKEQSEGEKSV" misc_feature 387..548 /gene="Drgx" /gene_synonym="Drg11; Prrxl1" /note="Homeobox domain; Region:...
Synonym: Drg11; Prrxl1
NM_145767.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box C12 (Hoxc12), mRNA. (843 bp)
FEATURES Location/Qualifiers source 1..843 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..843 /gene="Hoxc12" /note="homeo box C12" /db_xref="GeneID:300262" /db_xref="RGD:1310539" CDS 1..843 /gene="Hoxc12" /codon_start=1 /product="homeobox protein Hox-C12" /protein_id="NP_001100266.1" /db_xref="GeneID:300262" /db_xref="RGD:1310539" /translation="...
NM_001106796.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox and leucine zipper encoding (Homez), mRNA. (1785 bp)
LOCUS NM_152849 1785 bp mRNA linear ROD 13-APR-2021 DEFINITION Rattus norvegicus homeobox and leucine zipper encoding (Homez), mRNA. ACCESSION NM_152849 VERSION NM_152849.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC084701.1. On Oct 28, 2005 this...
NM_152849.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus iroquois homeobox 2 (Irx2), mRNA. (2635 bp)
LOCUS NM_001039505 2635 bp mRNA linear ROD 10-FEB-2021 DEFINITION Rattus norvegicus iroquois homeobox 2 (Irx2), mRNA. ACCESSION NM_001039505 XM_225077 VERSION NM_001039505.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata;...gene="Irx2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 664..783 /gene="Irx2" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" misc_feature 1240..1293 /gene="Irx2" /note="Motif in Iroquois-class homeodomain...
NM_001039505.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus one cut homeobox 3 (Onecut3), mRNA. (1659 bp)
LOCUS NM_001394957 1659 bp mRNA linear ROD 12-MAY-2021 DEFINITION Rattus norvegicus one cut homeobox 3 (Onecut3), mRNA. ACCESSION NM_001394957 VERSION NM_001394957.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000177.1. ##Evidence-Data-START##...
NM_001394957.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus BarH-like homeobox 2 (Barhl2), mRNA. (1577 bp)
LOCUS NM_022956 1577 bp mRNA linear ROD 10-APR-2021 DEFINITION Rattus norvegicus BarH-like homeobox 2 (Barhl2), mRNA. ACCESSION NM_022956 VERSION NM_022956.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 766..924 /gene="Barhl2" /gene_synonym="Barh; MBH1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 524..591 /gene="Barhl2" /gene_synonym="Barh; MBH1" /standard_name="Barhl2" /db_xref...
Synonym: Barh; MBH1
NM_022956.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus goosecoid homeobox (Gsc), mRNA. (1158 bp)
alignment:Splign:2.1.0" CDS 113..883 /gene="Gsc" /note="homeobox protein goosecoid-like" /codon_start=1 /product="homeobox protein goosecoid" /protein_id="NP_001178802.1" /db_xref="GeneID:317715" /db_xref="RGD:631425" /translation="MPASMFSIDNILAARPRCKDAVLPVAPSAAAPVVFPALHGDSLYGAGGGTSSDYGAFYPRPVAPGGAGLPAAVGGSRLGYNSYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSKASPEKREEEGKSDLDSDS" misc_feature 599..763 /gene="Gsc" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001"...
NM_001191873.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus LIM homeobox 1 (Lhx1), mRNA. (3390 bp)
LOCUS NM_145880 3390 bp mRNA linear ROD 21-APR-2021 DEFINITION Rattus norvegicus LIM homeobox 1 (Lhx1), mRNA. ACCESSION NM_145880 VERSION NM_145880.4 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (P63007.1); phosphorylation site" misc_feature 1147..1311 /gene="Lhx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1746 /gene="Lhx1" /note="chromosomal replication initiator protein DnaA;...
NM_145880.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus POU class 6 homeobox 2 (Pou6f2), mRNA. (6320 bp)
misc_feature 1677..2006 /gene="Pou6f2" /note="Pou domain - N-terminal to homeobox domain; Region: Pou; cl22952" /db_xref="CDD:419906" misc_feature 2076..2240 /gene="Pou6f2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" exon 436..527 /gene="Pou6f2" /inference="alignment:Splign:2.1.0" exon 528..756 /gene="Pou6f2" /inference="alignment:Splign:2.1.0" exon 757..1133 /gene="Pou6f2" /inference="alignment:Splign:2.1.0" exon 1134..1274 /gene="Pou6f2" /inference="alignment:Splign:2.1.0" exon 1275..1481 /gene="Pou6f2" /inference="alignment:Splign:2.1.0" exon 1482..1650 /gene...
NM_001101002.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus distal-less homeobox 1 (Dlx1), mRNA. (2757 bp)
upstream in-frame stop codon" CDS 550..1317 /gene="Dlx1" /note="homeobox Dlx1" /codon_start=1 /product="homeobox protein DLX-1" /protein_id="NP_001094001.1" /db_xref="GeneID:296500" /db_xref="RGD:1309593" /translation="MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGSSAGSYVPSYTSWYPSAHQEAMQQPQLM" misc_feature 940..1104 /gene="Dlx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" exon...
NM_001100531.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus pancreatic and duodenal homeobox 1 (Pdx1), mRNA. (1406 bp)
LOCUS NM_022852 1406 bp mRNA linear ROD 22-APR-2021 DEFINITION Rattus norvegicus pancreatic and duodenal homeobox 1 (Pdx1), mRNA. ACCESSION NM_022852 VERSION NM_022852.4 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata;...from UniProtKB/Swiss-Prot (P52947.1); Region: Antp-type hexapeptide" misc_feature 570..734 /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 576..578 /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /note="...
Synonym: Idx1; Ipf1; Stf1
NM_022852.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus SIX homeobox 3 (Six3), mRNA. (2677 bp)
LOCUS NM_023990 2677 bp mRNA linear ROD 26-FEB-2021 DEFINITION Rattus norvegicus SIX homeobox 3 (Six3), mRNA. ACCESSION NM_023990 XM_001059990 VERSION NM_023990.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000163.1. On Feb 26, 2021 this sequence...
NM_023990.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus retina and anterior neural fold homeobox (Rax), mRNA. (1029 bp)
LOCUS NM_053678 1029 bp mRNA linear ROD 09-APR-2021 DEFINITION Rattus norvegicus retina and anterior neural fold homeobox (Rax), mRNA. ACCESSION NM_053678 VERSION NM_053678.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata;...specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 421..579 /gene="Rax" /gene_synonym="Rx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 946..993 /gene="Rax" /gene_synonym="Rx" /note="OAR domain; Region: OAR;...
Synonym: Rx
NM_053678.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus msh homeobox 2 (Msx2), mRNA. (1976 bp)
homeobox 2" /db_xref="GeneID:25483" /db_xref="RGD:3116" CDS 1..804 /gene="Msx2" /note="hox-8.1; homeobox protein Hox-8-1; msh homeo box homolog 2" /codon_start=1 /product="homeobox protein MSX-2" /protein_id="NP_037114.2" /db_xref="GeneID:25483" /db_xref="RGD:3116" /translation="MASPSKGGDLFSSDEEGPAVLAGPGPGPGGAEGGAEERRVKVSSLPFSVEALMSDKKPPKESPAVPPDCASAGAVLRPLLLPGHGVRDAHSPGPLVKPFETASVKSENSEDGAPWIQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSGFSLPFPINSPLQAASIYSASYPFHRPVLPIPPVGLYATPVGYGMYHLS" misc_feature 433..597 /gene="Msx2" /note="Homeobox...
NM_012982.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus diencephalon/mesencephalon homeobox 1 (Dmbx1), mRNA. (4096 bp)
LOCUS NM_001107961 4096 bp mRNA linear ROD 10-FEB-2021 DEFINITION Rattus norvegicus diencephalon/mesencephalon homeobox 1 (Dmbx1), mRNA. ACCESSION NM_001107961 XM_001070471 XM_233404 VERSION NM_001107961.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota;...Otx3" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 217..378 /gene="Dmbx1" /gene_synonym="Otx3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(217..219,226..228,346..348,355..360,367..369) /gene="Dmbx1" /gene_synonym="...
Synonym: Otx3
NM_001107961.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus distal-less homeobox 5 (Dlx5), mRNA. (1390 bp)
gene_synonym="RDLX" /note="DLX-3; homeobox protein DLX-3" /codon_start=1 /product="homeobox protein DLX-5" /protein_id="NP_037075.1" /db_xref="GeneID:25431" /db_xref="RGD:2506" /translation="MTGVFDRRVPSIRSGDFQAPFPTSAAMHHPSQESPTLPESSATDSDYYSPAGAAPHGYCSPTSASYRKALNPYQYQYHSVNGSAAGYPAKAYADYGYASPYHQYGGAYNRVPSATSQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPTTSNQSPASSYLENSASWYPSAASSINSHLPPPGSLQHPLALASGTLY" misc_feature 272..532 /gene="Dlx5" /gene_synonym="RDLX" /note="Homeobox protein distal-less-like N terminal; Region:...
Synonym: RDLX
NM_012943.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus POU class 6 homeobox 1 (Pou6f1), mRNA. (2231 bp)
of N-A-Q-G-Q-V-I" misc_feature 1215..1439 /gene="Pou6f1" /gene_synonym="Brn5" /note="Pou domain - N-terminal to homeobox domain; Region: Pou; cl22952" /db_xref="CDD:304656" misc_feature order(1503..1517,1521..1523,1572..1574,1590..1592, 1629..1631,1635..1640,1647..1652,1656..1664,1668..1673) /gene="Pou6f1" /gene_synonym="Brn5" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1509..1670 /gene="Pou6f1" /gene_synonym="Brn5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order...
Synonym: Brn5
NM_001105746.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus orthodenticle homeobox 2 (Otx2), mRNA. (2339 bp)
gene="Otx2" /note="homeobox Otx2; orthodenticle homolog 2; homeobox protein OTX2-like" /codon_start=1 /product="homeobox protein OTX2" /protein_id="NP_001094036.1" /db_xref="GeneID:305858" /db_xref="RGD:1305705" /translation="MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL" misc_feature 569..727 /gene="Otx2" /note="Homeobox domain; Region: Homeobox; pfam00046" /...
NM_001100566.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus msh homeobox 1 (Msx1), mRNA. (1894 bp)
LOCUS NM_031059 1894 bp mRNA linear ROD 05-MAR-2021 DEFINITION Rattus norvegicus msh homeobox 1 (Msx1), mRNA. ACCESSION NM_031059 VERSION NM_031059.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000254.1 and D83036.1. On Mar 5, 2021 this sequence...
NM_031059.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus HOP homeobox (Hopx), mRNA. (1070 bp)
LOCUS NM_133621 1070 bp mRNA linear ROD 21-APR-2021 DEFINITION Rattus norvegicus HOP homeobox (Hopx), mRNA. ACCESSION NM_133621 VERSION NM_133621.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000252.1. On Nov 25, 2020 this sequence version replaced...
Synonym: GIIg15b; Hod; Obl
NM_133621.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus orthodenticle homeobox 1 (Otx1), mRNA. (1229 bp)
LOCUS NM_013109 1229 bp mRNA linear ROD 11-APR-2021 DEFINITION Rattus norvegicus orthodenticle homeobox 1 (Otx1), mRNA. ACCESSION NM_013109 VERSION NM_013109.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 165..323 /gene="Otx1" /gene_synonym="OTX1X" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 573..863 /gene="Otx1" /gene_synonym="OTX1X" /note="Otx1 transcription factor;...
Synonym: OTX1X
NM_013109.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus zinc fingers and homeoboxes 1 (Zhx1), mRNA. (4530 bp)
LOCUS NM_133620 4530 bp mRNA linear ROD 22-APR-2021 DEFINITION Rattus norvegicus zinc fingers and homeoboxes 1 (Zhx1), mRNA. ACCESSION NM_133620 VERSION NM_133620.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JACYVU010000185.1. On Nov 26, 2020 this...
NM_133620.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus aristaless related homeobox (Arx), mRNA. (2861 bp)
LOCUS NM_001100174 2861 bp mRNA linear ROD 10-APR-2021 DEFINITION Rattus norvegicus aristaless related homeobox (Arx), mRNA. ACCESSION NM_001100174 XM_001064618 XM_228590 VERSION NM_001100174.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1202..1360 /gene="Arx" /gene_synonym="RGD1562672" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 1784..1837 /gene="Arx" /gene_synonym="RGD1562672" /note="OAR domain; Region...
Synonym: RGD1562672
NM_001100174.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus Nanog homeobox (Nanog), mRNA. (2358 bp)
LOCUS NM_001100781 2358 bp mRNA linear ROD 07-MAR-2021 DEFINITION Rattus norvegicus Nanog homeobox (Nanog), mRNA. ACCESSION NM_001100781 XM_001060618 XM_575662 VERSION NM_001100781.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...Nanog" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 507..665 /gene="Nanog" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 358..626 /gene="Nanog" /inference="alignment:Splign:2.1.0" exon 627..713 /gene="Nanog...
NM_001100781.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus PROP paired-like homeobox 1 (Prop1), mRNA. (689 bp)
like homeodomain transcription factor; paired like homeodomain factor 1" /codon_start=1 /product="homeobox protein prophet of Pit-1" /protein_id="NP_705891.1" /db_xref="GeneID:266738" /db_xref="RGD:628759" /translation="MEAQRRSQQEKQTKGPVCGRSLPESQAASGTLISTVDRSPETSKRLSGTGLGRPKLCPQRGRPHSRRRHRTTFNPAQLGQLESAFGRNQYPDIWVREGLAQDTGLSEARIQVWFQNRRAKQRKQERSLLQPTAHLSPATFSGFLSESSPYPYTYTTPPPPVPCFPHPYNHALPSQPCTGASLTLPAQPEDWYPTLHPTHTGHLACMFSLSLETPKSWN" misc_feature 208..372 /gene="Prop1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" exon 113..336 /gene="Prop1" /inference="alignment...
NM_153627.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus POU class 2 homeobox 3 (Pou2f3), mRNA. (2407 bp)
LOCUS NM_001105745 2407 bp mRNA linear ROD 10-APR-2021 DEFINITION Rattus norvegicus POU class 2 homeobox 3 (Pou2f3), mRNA. ACCESSION NM_001105745 XM_001059708 XM_343378 VERSION NM_001105745.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa;...gene="Pou2f3" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 904..1065 /gene="Pou2f3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(904..906,913..915,1033..1035,1042..1047,1054..1056) /gene="Pou2f3" /note="specific DNA...
NM_001105745.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)

Data Export:

下記より最大10000件まで検索結果を取得できます。

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/ja/rn/homeobox
lang : ja | div : | spe : rn | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.079 | 0.079 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?source=Rattus norvegicus (Norway rat)?to=0&format=json
0.166 | 0.087 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?source=Rattus norvegicus (Norway rat)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.171 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]