GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-01 08:13:13, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       NM_031318                698 bp    mRNA    linear   ROD 03-APR-2024
DEFINITION  Rattus norvegicus dynein light chain Tctex-type 1 (Dynlt1), mRNA.
ACCESSION   NM_031318
VERSION     NM_031318.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 698)
  AUTHORS   Asante,D., Stevenson,N.L. and Stephens,D.J.
  TITLE     Subunit composition of the human cytoplasmic dynein-2 complex
  JOURNAL   J Cell Sci 127 (Pt 21), 4774-4787 (2014)
   PUBMED   25205765
REFERENCE   2  (bases 1 to 698)
  AUTHORS   Ribeiro,F.M., Devries,R.A., Hamilton,A., Guimaraes,I.M.,
            Cregan,S.P., Pires,R.G. and Ferguson,S.S.
  TITLE     Metabotropic glutamate receptor 5 knockout promotes motor and
            biochemical alterations in a mouse model of Huntington's disease
  JOURNAL   Hum Mol Genet 23 (8), 2030-2042 (2014)
   PUBMED   24282028
REFERENCE   3  (bases 1 to 698)
  AUTHORS   Xu,X., Zhang,Q., Hu,J.Y., Zhang,D.X., Jiang,X.P., Jia,J.Z.,
            Zhu,J.C. and Huang,Y.S.
  TITLE     Phosphorylation of DYNLT1 at serine 82 regulates microtubule
            stability and mitochondrial permeabilization in hypoxia
  JOURNAL   Mol Cells 36 (4), 322-332 (2013)
   PUBMED   24170091
  REMARK    GeneRIF: Data suggest that DYNLT1 phosphorylation at serine S82 is
            involved in microtubule and mitochondria regulation, and their
            interaction and cooperation contribute to the cellular hypoxic
            tolerance.
REFERENCE   4  (bases 1 to 698)
  AUTHORS   Allan,V.J.
  TITLE     Cytoplasmic dynein
  JOURNAL   Biochem Soc Trans 39 (5), 1169-1178 (2011)
   PUBMED   21936784
  REMARK    Review article
REFERENCE   5  (bases 1 to 698)
  AUTHORS   Fang,Y.D., Xu,X., Dang,Y.M., Zhang,Y.M., Zhang,J.P., Hu,J.Y.,
            Zhang,Q., Dai,X., Teng,M., Zhang,D.X. and Huang,Y.S.
  TITLE     MAP4 mechanism that stabilizes mitochondrial permeability
            transition in hypoxia: microtubule enhancement and DYNLT1
            interaction with VDAC1
  JOURNAL   PLoS One 6 (12), e28052 (2011)
   PUBMED   22164227
  REMARK    GeneRIF: there are two possible mechanisms triggered by MAP4:
            stabilization of MT networks; DYNLT1 modulation, which is connected
            with VDAC1, and inhibition of hypoxia-induced mitochondrial
            permeabilization
REFERENCE   6  (bases 1 to 698)
  AUTHORS   Yagil,C., Hubner,N., Monti,J., Schulz,H., Sapojnikov,M., Luft,F.C.,
            Ganten,D. and Yagil,Y.
  TITLE     Identification of hypertension-related genes through an integrated
            genomic-transcriptomic approach
  JOURNAL   Circ Res 96 (6), 617-625 (2005)
   PUBMED   15731461
REFERENCE   7  (bases 1 to 698)
  AUTHORS   Ligon,L.A., Tokito,M., Finklestein,J.M., Grossman,F.E. and
            Holzbaur,E.L.
  TITLE     A direct interaction between cytoplasmic dynein and kinesin I may
            coordinate motor activity
  JOURNAL   J Biol Chem 279 (18), 19201-19208 (2004)
   PUBMED   14985359
REFERENCE   8  (bases 1 to 698)
  AUTHORS   Malik-Hall,M., Poon,W.Y., Baker,M.D., Wood,J.N. and Okuse,K.
  TITLE     Sensory neuron proteins interact with the intracellular domains of
            sodium channel NaV1.8
  JOURNAL   Brain Res Mol Brain Res 110 (2), 298-304 (2003)
   PUBMED   12591166
REFERENCE   9  (bases 1 to 698)
  AUTHORS   Tai,A.W., Chuang,J.Z., Bode,C., Wolfrum,U. and Sung,C.H.
  TITLE     Rhodopsin's carboxy-terminal cytoplasmic tail acts as a membrane
            receptor for cytoplasmic dynein by binding to the dynein light
            chain Tctex-1
  JOURNAL   Cell 97 (7), 877-887 (1999)
   PUBMED   10399916
REFERENCE   10 (bases 1 to 698)
  AUTHORS   Nagano,F., Orita,S., Sasaki,T., Naito,A., Sakaguchi,G., Maeda,M.,
            Watanabe,T., Kominami,E., Uchiyama,Y. and Takai,Y.
  TITLE     Interaction of Doc2 with tctex-1, a light chain of cytoplasmic
            dynein. Implication in dynein-dependent vesicle transport
  JOURNAL   J Biol Chem 273 (46), 30065-30068 (1998)
   PUBMED   9804756
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AJ131437.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AJ131437.1, BC166879.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760383, SAMEA5760389
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..698
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="1"
                     /map="1q11"
     gene            1..698
                     /gene="Dynlt1"
                     /gene_synonym="AGS2; Tctex1"
                     /note="dynein light chain Tctex-type 1"
                     /db_xref="GeneID:83462"
                     /db_xref="RGD:620261"
     exon            1..41
                     /gene="Dynlt1"
                     /gene_synonym="AGS2; Tctex1"
                     /inference="alignment:Splign:2.1.0"
     CDS             15..356
                     /gene="Dynlt1"
                     /gene_synonym="AGS2; Tctex1"
                     /note="T-complex testis-specific protein 1 homolog;
                     activator of G-protein signaling 2; t-complex testis
                     expressed 1"
                     /codon_start=1
                     /product="dynein light chain Tctex-type 1"
                     /protein_id="NP_112608.1"
                     /db_xref="GeneID:83462"
                     /db_xref="RGD:620261"
                     /translation="
MEDFQASEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI"
     misc_feature    15..17
                     /gene="Dynlt1"
                     /gene_synonym="AGS2; Tctex1"
                     /note="N-acetylmethionine.
                     /evidence=ECO:0000250|UniProtKB:P63172; propagated from
                     UniProtKB/Swiss-Prot (Q9Z336.1); acetylation site"
     misc_feature    48..353
                     /gene="Dynlt1"
                     /gene_synonym="AGS2; Tctex1"
                     /note="dynein light chain (DLC)-like domain found in
                     dynein light chain Tctex-type 1 (DYNLT1) and similar
                     proteins; Region: DLC-like_DYNLT1; cd21462"
                     /db_xref="CDD:412010"
     misc_feature    135..353
                     /gene="Dynlt1"
                     /gene_synonym="AGS2; Tctex1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z336.1);
                     Region: Interaction with GNB1.
                     /evidence=ECO:0000269|PubMed:17491591"
     misc_feature    order(198..200,204..224,234..266,270..272,282..284,
                     339..341,345..347)
                     /gene="Dynlt1"
                     /gene_synonym="AGS2; Tctex1"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:412010"
     exon            42..83
                     /gene="Dynlt1"
                     /gene_synonym="AGS2; Tctex1"
                     /inference="alignment:Splign:2.1.0"
     exon            84..207
                     /gene="Dynlt1"
                     /gene_synonym="AGS2; Tctex1"
                     /inference="alignment:Splign:2.1.0"
     exon            208..285
                     /gene="Dynlt1"
                     /gene_synonym="AGS2; Tctex1"
                     /inference="alignment:Splign:2.1.0"
     exon            286..698
                     /gene="Dynlt1"
                     /gene_synonym="AGS2; Tctex1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gcgctagagggaagatggaagacttccaggcctccgaggagactgcatttgttgtggatgaagtgagcaacattgtaaaggaggctatagaaagtgccatcggcggtaacgcctaccagcacagcaaagtcaaccagtggaccactaatgttgtagaacagactttgagccaactcaccaaactggggaaaccatttaaatacattgtgacctgtgtgatcatgcagaagaatggtgctgggttacacaccgcaagttcctgcttctgggacagctccacggacgggagctgcacagtccgatgggagaacaagaccatgtactgcatcgtcagtgccttcggactgtccatctgaccgcctgactgcctcagcctccggttccagcgtttctagtccatcttaccaccagctatgttgggcggataccttcctcctctttaagttgttctgaggcactcccaaaatgtagagaaataaaccaaatgaccctggccacaggaaccacacgacggacactaggcagatgagcagccacctgtcatccaaggcaggcagtaccagttgtcttaactgtcttctcaaaggtgctaagatctcaagtctgctagtggaaacttctctactttctgaaatgattcagatacactaattttccacactttatacttttgttagaataataaattattcagaatt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]