2024-11-01 08:42:32, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS NM_024127 1237 bp mRNA linear ROD 22-MAR-2023 DEFINITION Rattus norvegicus growth arrest and DNA-damage-inducible, alpha (Gadd45a), mRNA. ACCESSION NM_024127 VERSION NM_024127.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1237) AUTHORS Wang Y, Gao H, Cao X, Li Z, Kuang Y, Ji Y and Li Y. TITLE Role of GADD45A in myocardial ischemia/reperfusion through mediation of the JNK/p38 MAPK and STAT3/VEGF pathways JOURNAL Int J Mol Med 50 (6) (2022) PUBMED 36331027 REMARK GeneRIF: Role of GADD45A in myocardial ischemia/reperfusion through mediation of the JNK/p38 MAPK and STAT3/VEGF pathways. REFERENCE 2 (bases 1 to 1237) AUTHORS Sun RX, Sun ZH, Ren Q, Li L, Yin L, Li F and Su X. TITLE Gadd45alpha affects retinal ganglion cell injury in chronic ocular hypertension rats by regulating p38MAPK pathway JOURNAL Gene 763, 145030 (2020) PUBMED 32755658 REMARK GeneRIF: Gadd45alpha affects retinal ganglion cell injury in chronic ocular hypertension rats by regulating p38MAPK pathway. REFERENCE 3 (bases 1 to 1237) AUTHORS Yoshihara T, Tsuzuki T, Chang SW, Kakigi R, Sugiura T and Naito H. TITLE Exercise preconditioning attenuates hind limb unloading-induced gastrocnemius muscle atrophy possibly via the HDAC4/Gadd45 axis in old rats JOURNAL Exp Gerontol 122, 34-41 (2019) PUBMED 31009659 REMARK GeneRIF: The data indicated that a single bout of preconditioning exercise prior to hindlimb unloading may exert a protective effect in disuse muscle atrophy in old rats and that these effects may be partially mediated by the HDAC4/Gadd45alpha axis. REFERENCE 4 (bases 1 to 1237) AUTHORS Zhou L, Wang W, Yang C, Zeng T, Hu M, Wang X, Li N, Sun K, Wang C, Zhou J, Ren M and Yan L. TITLE GADD45a Promotes Active DNA Demethylation of the MMP-9 Promoter via Base Excision Repair Pathway in AGEs-Treated Keratinocytes and in Diabetic Male Rat Skin JOURNAL Endocrinology 159 (2), 1172-1186 (2018) PUBMED 29244109 REMARK GeneRIF: A mechanism in which GADD45a is required for demethylation of the MMP-9 promoter and the induction of diabetic wound healing. The inhibition of GADD45a might be a therapeutic strategy for diabetic foot ulcers. REFERENCE 5 (bases 1 to 1237) AUTHORS Lai CY, Hsieh MC, Ho YC, Lee AS, Wang HH, Cheng JK, Chau YP and Peng HY. TITLE Growth Arrest and DNA-damage-inducible Protein 45beta-mediated DNA Demethylation of Voltage-dependent T-type Calcium Channel 3.2 Subunit Enhances Neuropathic Allodynia after Nerve Injury in Rats JOURNAL Anesthesiology 126 (6), 1077-1095 (2017) PUBMED 28346321 REMARK GeneRIF: Growth arrest and DNA-damage-inducible protein 45 (Gadd45) is known to relieve methylation-induced gene silencing by promoting DNA demethylation. REFERENCE 6 (bases 1 to 1237) AUTHORS Tran H, Brunet A, Grenier JM, Datta SR, Fornace AJ Jr, DiStefano PS, Chiang LW and Greenberg ME. TITLE DNA repair pathway stimulated by the forkhead transcription factor FOXO3a through the Gadd45 protein JOURNAL Science 296 (5567), 530-534 (2002) PUBMED 11964479 REMARK GeneRIF: appeared to be a direct target of FOXO3a that mediates part of FOXO3a's effects on DNA repair REFERENCE 7 (bases 1 to 1237) AUTHORS Wang XW, Zhan Q, Coursen JD, Khan MA, Kontny HU, Yu L, Hollander MC, O'Connor PM, Fornace AJ Jr and Harris CC. TITLE GADD45 induction of a G2/M cell cycle checkpoint JOURNAL Proc Natl Acad Sci U S A 96 (7), 3706-3711 (1999) PUBMED 10097101 REFERENCE 8 (bases 1 to 1237) AUTHORS Takekawa M and Saito H. TITLE A family of stress-inducible GADD45-like proteins mediate activation of the stress-responsive MTK1/MEKK4 MAPKKK JOURNAL Cell 95 (4), 521-530 (1998) PUBMED 9827804 REFERENCE 9 (bases 1 to 1237) AUTHORS Yoshida T, Okazaki T, Hughes PE, Schneider EL and Mori N. TITLE Cloning of rat GADD45 gene and induction analysis following ionizing radiation in vivo JOURNAL FEBS Lett 380 (1-2), 87-92 (1996) PUBMED 8603754 REFERENCE 10 (bases 1 to 1237) AUTHORS Yoshida T, Schneider EL and Mori N. TITLE Cloning of the rat Gadd45 cDNA and its mRNA expression in the brain JOURNAL Gene 151 (1-2), 253-255 (1994) PUBMED 7828885 REMARK Erratum:[Gene. 1995 Dec 12;166(2):343-4. PMID: 8543192] COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC081795.1. On Mar 27, 2005 this sequence version replaced NM_024127.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC081795.1, FQ216523.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN12840115, SAMN16676807 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1237 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="4" /map="4q31" gene 1..1237 /gene="Gadd45a" /gene_synonym="Ddit1; Gadd45" /note="growth arrest and DNA-damage-inducible, alpha" /db_xref="GeneID:25112" /db_xref="RGD:2654" exon 1..194 /gene="Gadd45a" /gene_synonym="Ddit1; Gadd45" /inference="alignment:Splign:2.1.0" misc_feature 130..132 /gene="Gadd45a" /gene_synonym="Ddit1; Gadd45" /note="upstream in-frame stop codon" CDS 151..648 /gene="Gadd45a" /gene_synonym="Ddit1; Gadd45" /note="DDIT-1; DNA damage-inducible transcript 1 protein; growth arrest and DNA-damage-inducible 45 alpha; DNA-damage-inducible transcript 1" /codon_start=1 /product="growth arrest and DNA damage-inducible protein GADD45 alpha" /protein_id="NP_077041.2" /db_xref="GeneID:25112" /db_xref="RGD:2654" /translation="
MTLEEFSAAEQKIERMDTVGDALEEVLSKARSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIRAFCCENDINILRVSNPGRLAELLLLENDKSPAESGGAAQTPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER"
misc_feature 154..156 /gene="Gadd45a" /gene_synonym="Ddit1; Gadd45" /note="Phosphothreonine. /evidence=ECO:0000250|UniProtKB:P24522; propagated from UniProtKB/Swiss-Prot (P48317.1); phosphorylation site" misc_feature 211..465 /gene="Gadd45a" /gene_synonym="Ddit1; Gadd45" /note="Ribosomal protein L7Ae/L30e/S12e/Gadd45 family; Region: Ribosomal_L7Ae; pfam01248" /db_xref="CDD:426153" exon 195..296 /gene="Gadd45a" /gene_synonym="Ddit1; Gadd45" /inference="alignment:Splign:2.1.0" exon 297..534 /gene="Gadd45a" /gene_synonym="Ddit1; Gadd45" /inference="alignment:Splign:2.1.0" exon 535..1213 /gene="Gadd45a" /gene_synonym="Ddit1; Gadd45" /inference="alignment:Splign:2.1.0" ORIGIN
cgaggcagctgtgcagtgttccccagcgaggctaagcaagaagccggcaagagcagagacgcgagggtgggagccagcgcagagccggcgccgggcactgtgggggccaggagcagcccgcgcgccgcgtgagggactcgcacttgcaatatgactttggaggaattctcggccgcagagcagaagatcgaaaggatggacacggtgggcgatgccctggaggaagtgctcagcaaggctcggagtcagcgcaccataactgtcggcgtgtacgaggcagccaagctgctcaacgtagacccggacaacgtggtcctgtgcctgctggctgcggatgaagatgacgaccgggacgtggctctgcagatccatttcaccctcattcgtgctttctgttgcgagaacgacatcaacatcctgcgggtcagcaacccgggtcggctggcagagctgttgctactggagaacgacaagagccccgctgagagcgggggcgctgcgcagaccccggacttacactgtgtgctggtgacgaacccacattcatcacaatggaaggatcctgccttaagtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggtgccagtgattaatctccccgaacggtgattccccgaacggtgatggcatctgaatggaaataactgaaccaaattgcactgaagttttgaaatacctttgtagttactcaagcagtcactccccacgctgatgcaaggattacagaaactgatgtcaaggggctgagttcaactacaggagggctaggagatgactttgcagaaggagagagaggtgagactgaaggaggaagctgtgtggaaacagaaatccaagtcaaaagggacaaaaaaactacaaagaactgtgcaagaaagaaaactattaatttaggatggccgggttacagtaaagtaaaccaaatattgctttgttgaaactttaaatgtgtagcaatattttgggtattttttttggtcttcatgccctcaaataaaagaaaagtgaaaagggttaatcatattttcaagccacagtttaatgtattttgatgagatgttaaattctcagaagttttattataaatcgtactaagttattttatgatgtgaaaggttatttatgataaaacgtttttgaagcacattatctaaaataaactggtatggaataaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]