GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-01 08:42:32, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       NM_024127               1237 bp    mRNA    linear   ROD 22-MAR-2023
DEFINITION  Rattus norvegicus growth arrest and DNA-damage-inducible, alpha
            (Gadd45a), mRNA.
ACCESSION   NM_024127
VERSION     NM_024127.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1237)
  AUTHORS   Wang Y, Gao H, Cao X, Li Z, Kuang Y, Ji Y and Li Y.
  TITLE     Role of GADD45A in myocardial ischemia/reperfusion through
            mediation of the JNK/p38 MAPK and STAT3/VEGF pathways
  JOURNAL   Int J Mol Med 50 (6) (2022)
   PUBMED   36331027
  REMARK    GeneRIF: Role of GADD45A in myocardial ischemia/reperfusion through
            mediation of the JNK/p38 MAPK and STAT3/VEGF pathways.
REFERENCE   2  (bases 1 to 1237)
  AUTHORS   Sun RX, Sun ZH, Ren Q, Li L, Yin L, Li F and Su X.
  TITLE     Gadd45alpha affects retinal ganglion cell injury in chronic ocular
            hypertension rats by regulating p38MAPK pathway
  JOURNAL   Gene 763, 145030 (2020)
   PUBMED   32755658
  REMARK    GeneRIF: Gadd45alpha affects retinal ganglion cell injury in
            chronic ocular hypertension rats by regulating p38MAPK pathway.
REFERENCE   3  (bases 1 to 1237)
  AUTHORS   Yoshihara T, Tsuzuki T, Chang SW, Kakigi R, Sugiura T and Naito H.
  TITLE     Exercise preconditioning attenuates hind limb unloading-induced
            gastrocnemius muscle atrophy possibly via the HDAC4/Gadd45 axis in
            old rats
  JOURNAL   Exp Gerontol 122, 34-41 (2019)
   PUBMED   31009659
  REMARK    GeneRIF: The data indicated that a single bout of preconditioning
            exercise prior to hindlimb unloading may exert a protective effect
            in disuse muscle atrophy in old rats and that these effects may be
            partially mediated by the HDAC4/Gadd45alpha axis.
REFERENCE   4  (bases 1 to 1237)
  AUTHORS   Zhou L, Wang W, Yang C, Zeng T, Hu M, Wang X, Li N, Sun K, Wang C,
            Zhou J, Ren M and Yan L.
  TITLE     GADD45a Promotes Active DNA Demethylation of the MMP-9 Promoter via
            Base Excision Repair Pathway in AGEs-Treated Keratinocytes and in
            Diabetic Male Rat Skin
  JOURNAL   Endocrinology 159 (2), 1172-1186 (2018)
   PUBMED   29244109
  REMARK    GeneRIF: A mechanism in which GADD45a is required for demethylation
            of the MMP-9 promoter and the induction of diabetic wound healing.
            The inhibition of GADD45a might be a therapeutic strategy for
            diabetic foot ulcers.
REFERENCE   5  (bases 1 to 1237)
  AUTHORS   Lai CY, Hsieh MC, Ho YC, Lee AS, Wang HH, Cheng JK, Chau YP and
            Peng HY.
  TITLE     Growth Arrest and DNA-damage-inducible Protein 45beta-mediated DNA
            Demethylation of Voltage-dependent T-type Calcium Channel 3.2
            Subunit Enhances Neuropathic Allodynia after Nerve Injury in Rats
  JOURNAL   Anesthesiology 126 (6), 1077-1095 (2017)
   PUBMED   28346321
  REMARK    GeneRIF: Growth arrest and DNA-damage-inducible protein 45 (Gadd45)
            is known to relieve methylation-induced gene silencing by promoting
            DNA demethylation.
REFERENCE   6  (bases 1 to 1237)
  AUTHORS   Tran H, Brunet A, Grenier JM, Datta SR, Fornace AJ Jr, DiStefano
            PS, Chiang LW and Greenberg ME.
  TITLE     DNA repair pathway stimulated by the forkhead transcription factor
            FOXO3a through the Gadd45 protein
  JOURNAL   Science 296 (5567), 530-534 (2002)
   PUBMED   11964479
  REMARK    GeneRIF: appeared to be a direct target of FOXO3a that mediates
            part of FOXO3a's effects on DNA repair
REFERENCE   7  (bases 1 to 1237)
  AUTHORS   Wang XW, Zhan Q, Coursen JD, Khan MA, Kontny HU, Yu L, Hollander
            MC, O'Connor PM, Fornace AJ Jr and Harris CC.
  TITLE     GADD45 induction of a G2/M cell cycle checkpoint
  JOURNAL   Proc Natl Acad Sci U S A 96 (7), 3706-3711 (1999)
   PUBMED   10097101
REFERENCE   8  (bases 1 to 1237)
  AUTHORS   Takekawa M and Saito H.
  TITLE     A family of stress-inducible GADD45-like proteins mediate
            activation of the stress-responsive MTK1/MEKK4 MAPKKK
  JOURNAL   Cell 95 (4), 521-530 (1998)
   PUBMED   9827804
REFERENCE   9  (bases 1 to 1237)
  AUTHORS   Yoshida T, Okazaki T, Hughes PE, Schneider EL and Mori N.
  TITLE     Cloning of rat GADD45 gene and induction analysis following
            ionizing radiation in vivo
  JOURNAL   FEBS Lett 380 (1-2), 87-92 (1996)
   PUBMED   8603754
REFERENCE   10 (bases 1 to 1237)
  AUTHORS   Yoshida T, Schneider EL and Mori N.
  TITLE     Cloning of the rat Gadd45 cDNA and its mRNA expression in the brain
  JOURNAL   Gene 151 (1-2), 253-255 (1994)
   PUBMED   7828885
  REMARK    Erratum:[Gene. 1995 Dec 12;166(2):343-4. PMID: 8543192]
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC081795.1.
            
            On Mar 27, 2005 this sequence version replaced NM_024127.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC081795.1, FQ216523.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN12840115, SAMN16676807
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1237
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="4"
                     /map="4q31"
     gene            1..1237
                     /gene="Gadd45a"
                     /gene_synonym="Ddit1; Gadd45"
                     /note="growth arrest and DNA-damage-inducible, alpha"
                     /db_xref="GeneID:25112"
                     /db_xref="RGD:2654"
     exon            1..194
                     /gene="Gadd45a"
                     /gene_synonym="Ddit1; Gadd45"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    130..132
                     /gene="Gadd45a"
                     /gene_synonym="Ddit1; Gadd45"
                     /note="upstream in-frame stop codon"
     CDS             151..648
                     /gene="Gadd45a"
                     /gene_synonym="Ddit1; Gadd45"
                     /note="DDIT-1; DNA damage-inducible transcript 1 protein;
                     growth arrest and DNA-damage-inducible 45 alpha;
                     DNA-damage-inducible transcript 1"
                     /codon_start=1
                     /product="growth arrest and DNA damage-inducible protein
                     GADD45 alpha"
                     /protein_id="NP_077041.2"
                     /db_xref="GeneID:25112"
                     /db_xref="RGD:2654"
                     /translation="
MTLEEFSAAEQKIERMDTVGDALEEVLSKARSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIRAFCCENDINILRVSNPGRLAELLLLENDKSPAESGGAAQTPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER"
     misc_feature    154..156
                     /gene="Gadd45a"
                     /gene_synonym="Ddit1; Gadd45"
                     /note="Phosphothreonine.
                     /evidence=ECO:0000250|UniProtKB:P24522; propagated from
                     UniProtKB/Swiss-Prot (P48317.1); phosphorylation site"
     misc_feature    211..465
                     /gene="Gadd45a"
                     /gene_synonym="Ddit1; Gadd45"
                     /note="Ribosomal protein L7Ae/L30e/S12e/Gadd45 family;
                     Region: Ribosomal_L7Ae; pfam01248"
                     /db_xref="CDD:426153"
     exon            195..296
                     /gene="Gadd45a"
                     /gene_synonym="Ddit1; Gadd45"
                     /inference="alignment:Splign:2.1.0"
     exon            297..534
                     /gene="Gadd45a"
                     /gene_synonym="Ddit1; Gadd45"
                     /inference="alignment:Splign:2.1.0"
     exon            535..1213
                     /gene="Gadd45a"
                     /gene_synonym="Ddit1; Gadd45"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
cgaggcagctgtgcagtgttccccagcgaggctaagcaagaagccggcaagagcagagacgcgagggtgggagccagcgcagagccggcgccgggcactgtgggggccaggagcagcccgcgcgccgcgtgagggactcgcacttgcaatatgactttggaggaattctcggccgcagagcagaagatcgaaaggatggacacggtgggcgatgccctggaggaagtgctcagcaaggctcggagtcagcgcaccataactgtcggcgtgtacgaggcagccaagctgctcaacgtagacccggacaacgtggtcctgtgcctgctggctgcggatgaagatgacgaccgggacgtggctctgcagatccatttcaccctcattcgtgctttctgttgcgagaacgacatcaacatcctgcgggtcagcaacccgggtcggctggcagagctgttgctactggagaacgacaagagccccgctgagagcgggggcgctgcgcagaccccggacttacactgtgtgctggtgacgaacccacattcatcacaatggaaggatcctgccttaagtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggtgccagtgattaatctccccgaacggtgattccccgaacggtgatggcatctgaatggaaataactgaaccaaattgcactgaagttttgaaatacctttgtagttactcaagcagtcactccccacgctgatgcaaggattacagaaactgatgtcaaggggctgagttcaactacaggagggctaggagatgactttgcagaaggagagagaggtgagactgaaggaggaagctgtgtggaaacagaaatccaagtcaaaagggacaaaaaaactacaaagaactgtgcaagaaagaaaactattaatttaggatggccgggttacagtaaagtaaaccaaatattgctttgttgaaactttaaatgtgtagcaatattttgggtattttttttggtcttcatgccctcaaataaaagaaaagtgaaaagggttaatcatattttcaagccacagtttaatgtattttgatgagatgttaaattctcagaagttttattataaatcgtactaagttattttatgatgtgaaaggttatttatgataaaacgtttttgaagcacattatctaaaataaactggtatggaataaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]