2024-05-02 17:23:46, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_039093684 1123 bp mRNA linear ROD 11-JUN-2023 DEFINITION PREDICTED: Rattus norvegicus glia maturation factor, beta (Gmfb), transcript variant X3, mRNA. ACCESSION XM_039093684 VERSION XM_039093684.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_051350.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_015227675.2-RS_2023_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/06/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1123 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN/NHsdMcwi" /db_xref="taxon:10116" /chromosome="15" /sex="male" /tissue_type="kidney" /country="USA: Wisconsin, Milwaukee, Medical College of Wisconsin" /collection_date="2019-03-08" /collected_by="Rebecca Schilling" gene 1..1123 /gene="Gmfb" /note="glia maturation factor, beta; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 ESTs, 2 long SRA reads, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 248 samples with support for all annotated introns" /db_xref="GeneID:81661" /db_xref="RGD:70910" CDS 789..1097 /gene="Gmfb" /codon_start=1 /product="glia maturation factor beta isoform X3" /protein_id="XP_038949612.1" /db_xref="GeneID:81661" /db_xref="RGD:70910" /translation="
MSESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDKRLVVLDEELEGVSPDELKDELPERQPRPSLCIVINTSTTMAGSPTLCALSSPVLWGANLSSR"
misc_feature 813..>989 /gene="Gmfb" /note="Actin depolymerization factor/cofilin- and gelsolin-like domains; Region: ADF_gelsolin; cl15697" /db_xref="CDD:449582" ORIGIN
actaaaatttttttttatttcttatatttctttttcataaagttgccagccctttcatccacatcggcttttttgtaccccatactgtttcttaaaaagtcaagtttatctcagttttggaatgccagtagtaatacatttaaaaggtcgtaacttttgagtgtcgcactttgaaacagtaacagcacctgggcttcagagttcagtttggctgtgacttgagagtaagagcccgcatgatcacaactgatcaccatttattgagtatgaatactctttggaaaataaacgtatctagcaagttctgggaagcagacagggtcacggatggcgctctgggtcaggcggaaggatggaagcggcgtctacctttgaaaagccttaaatctggaagtaaactgtaaccaacacgcacatttaccgttaaaatcactgactcaggtttgtcaccacgacattgctgccgttcaggcttgtagaatatttaaagataccaagaatctgcgcactgcagcccggctcattcctgggtaaaccagcaggcagaacatccttagcagccacaagctgagcccgcgtccgcgtccgcgtccgcgtccgcgattcgcagaattttgggcctcgcctcccgccgtccgctgtcacgtgcgggccacggcggccgcgtagttaggtggggaacactgagctgtgtgccagccgaagcaggaagggaggtggctgcagagccattcttaaaggggcccaagagatcatacggcaacggacggctgacgaccggaaggaaaatgagtgagtctttggtggtttgtgatgttgctgaagatttagtggaaaagctgagaaagtttcgttttcgaaaagaaacccacaatgctgctattataatgaagattgacaaggataaacgcttggtggtgctggatgaggagctcgagggtgtctctccagatgaacttaaagatgaactacctgaacggcaacctcgaccttcattgtgtatagttataaataccagcacgacgatggccgggtctcctaccctctgtgctttatcttctccagtcctctggggtgcaaacctgagcagcagatgatgtacgctgggagtaagaacaagctg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]