GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-09 08:42:58, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_039093200             881 bp    mRNA    linear   ROD 11-JUN-2023
DEFINITION  PREDICTED: Rattus norvegicus claudin 10 (Cldn10), transcript
            variant X3, mRNA.
ACCESSION   XM_039093200
VERSION     XM_039093200.1
DBLINK      BioProject: PRJNA677964
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_051350.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_015227675.2-RS_2023_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/06/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..881
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN/NHsdMcwi"
                     /db_xref="taxon:10116"
                     /chromosome="15"
                     /sex="male"
                     /tissue_type="kidney"
                     /country="USA: Wisconsin, Milwaukee, Medical College of
                     Wisconsin"
                     /collection_date="2019-03-08"
                     /collected_by="Rebecca Schilling"
     gene            1..881
                     /gene="Cldn10"
                     /note="claudin 10; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 10 ESTs, 1 Protein, and
                     100% coverage of the annotated genomic feature by RNAseq
                     alignments, including 34 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:290485"
                     /db_xref="RGD:1308027"
     CDS             139..663
                     /gene="Cldn10"
                     /codon_start=1
                     /product="claudin-10 isoform X3"
                     /protein_id="XP_038949128.1"
                     /db_xref="GeneID:290485"
                     /db_xref="RGD:1308027"
                     /translation="
MALSSPPPLILPTCGRCYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGVVFILSGLCSMTGCSLYANKITTEFFDPLFMEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRMGYTYNGPTSVMSSRTKYQGGEGDFKTTGPSKQFDKNAYV"
     misc_feature    <190..504
                     /gene="Cldn10"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      
gaaccagcgcgaacgctgctgcagccggcagcatggctagcacggccttggaaatcatcgccttcgtcgtctccatctcgggctgggtgctggtgtcttccacactacccaccgactactggaaggtctccaccatcgatggcactgtcatcaccaccgccacttattttgccaacctgtggaagatgttacatccaggcgtgtagaggactaatgattgccgcggtcagcctgggcttcttcggttccatttttgcactctttggaatgaagtgtaccaaagtcggaggctcggataaagccaaagctaagattgcttgcttggctggggttgtattcatattgtcaggtctgtgttccatgacgggctgttccctgtacgcgaacaaaatcacaacggaattctttgatcccctctttatggagcaaaagtatgaattgggggctgccctcttcatcggatgggcaggagcttctctctgcatcattggcggtgtcatattttgcttttcaatatccgacaacaacaaaacacccagaatgggctacacgtacaatggacccacgtcagtcatgtcttcccggaccaagtatcaaggcggagaaggagattttaaaaccacaggcccttcaaaacagtttgataaaaatgcctatgtctaaagagctctggcaagccgcgtctcgagtttgttgcgcaagagaactgttctcacaatggtccttccaaggctcccctgtaattatcacttaagctgtttttttttttttaaaatatgaatttgaagaatgttgattggatgtaaatgttcttatagttatatactaatcatttttttctgttgtgcctttctataagggaaataaacaggttatttaca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]