2024-04-25 04:07:30, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_181550 892 bp mRNA linear ROD 10-SEP-2023 DEFINITION Rattus norvegicus sequestosome 1 (Sqstm1), transcript variant 2, mRNA. ACCESSION NM_181550 VERSION NM_181550.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 892) AUTHORS Chernyshova EV, Gureev AP, Sadovnikova IS, Plotnikov EY, Silachev DN, Zorov DB and Popov VN. TITLE The Relationship of p62 Gene Expression with Integrity of Mitochondrial DNA and the Level of Lipid Peroxidation Products in Skeletal Muscles of Rats of Different Ages Exposed to Different Feeding Protocols JOURNAL Bull Exp Biol Med 175 (2), 245-248 (2023) PUBMED 37466855 REMARK GeneRIF: The Relationship of p62 Gene Expression with Integrity of Mitochondrial DNA and the Level of Lipid Peroxidation Products in Skeletal Muscles of Rats of Different Ages Exposed to Different Feeding Protocols. REFERENCE 2 (bases 1 to 892) AUTHORS Zeng T, Zhang S, He Y, Liu Z and Cheng Q. TITLE MiR-361-5p promotes oxygen-glucose deprivation/re-oxygenation induced neuronal injury by negatively regulating SQSTM1 in vitro JOURNAL Metab Brain Dis 36 (8), 2359-2368 (2021) PUBMED 34581931 REMARK GeneRIF: MiR-361-5p promotes oxygen-glucose deprivation/re-oxygenation induced neuronal injury by negatively regulating SQSTM1 in vitro. REFERENCE 3 (bases 1 to 892) AUTHORS Feng X, Chen L, Guo W, Zhang Y, Lai X, Shao L and Li Y. TITLE Graphene oxide induces p62/SQSTM-dependent apoptosis through the impairment of autophagic flux and lysosomal dysfunction in PC12 cells JOURNAL Acta Biomater 81, 278-292 (2018) PUBMED 30273743 REMARK GeneRIF: Graphene oxide induces p62/SQSTM-dependent apoptosis through the impairment of autophagic flux and lysosomal dysfunction in PC12 cells. REFERENCE 4 (bases 1 to 892) AUTHORS Bresciani A, Spiezia MC, Boggio R, Cariulo C, Nordheim A, Altobelli R, Kuhlbrodt K, Dominguez C, Munoz-Sanjuan I, Wityak J, Fodale V, Marchionini DM and Weiss A. TITLE Quantifying autophagy using novel LC3B and p62 TR-FRET assays JOURNAL PLoS One 13 (3), e0194423 (2018) PUBMED 29554128 REMARK GeneRIF: Quantifying autophagy using novel LC3B and p62 TR-FRET assays. Publication Status: Online-Only REFERENCE 5 (bases 1 to 892) AUTHORS Chung H, Choi J and Park S. TITLE Ghrelin protects adult rat hippocampal neural stem cells from excessive autophagy during oxygen-glucose deprivation JOURNAL Endocr J 65 (1), 63-73 (2018) PUBMED 29057768 REMARK GeneRIF: Data suggest that neuroprotection via ghrelin involves up-regulation of Bcl-2 (B cell lymphoma 2 associated oncogene) and p-62/Sqstm1 (ubiquitin-binding protein p62) plus down-regulation of LC3-II (microtubule-associated protein 1 light chain 3) and Beclin-1. Studies were conducted in adult hippocampal neural stem cells in primary culture. REFERENCE 6 (bases 1 to 892) AUTHORS Wooten MW, Seibenhener ML, Mamidipudi V, Diaz-Meco MT, Barker PA and Moscat J. TITLE The atypical protein kinase C-interacting protein p62 is a scaffold for NF-kappaB activation by nerve growth factor JOURNAL J Biol Chem 276 (11), 7709-7712 (2001) PUBMED 11244088 REFERENCE 7 (bases 1 to 892) AUTHORS Kuusisto E, Suuronen T and Salminen A. TITLE Ubiquitin-binding protein p62 expression is induced during apoptosis and proteasomal inhibition in neuronal cells JOURNAL Biochem Biophys Res Commun 280 (1), 223-228 (2001) PUBMED 11162503 REFERENCE 8 (bases 1 to 892) AUTHORS Gong J, Xu J, Bezanilla M, van Huizen R, Derin R and Li M. TITLE Differential stimulation of PKC phosphorylation of potassium channels by ZIP1 and ZIP2 JOURNAL Science 285 (5433), 1565-1569 (1999) PUBMED 10477520 REFERENCE 9 (bases 1 to 892) AUTHORS Nakaso K, Kitayama M, Ishii T, Bannai S, Yanagawa T, Kimura K, Nakashima K, Ohama E and Yamada K. TITLE Effects of kainate-mediated excitotoxicity on the expression of rat counterparts of A170 and MSP23 stress proteins in the brain JOURNAL Brain Res Mol Brain Res 69 (2), 155-163 (1999) PUBMED 10366737 REFERENCE 10 (bases 1 to 892) AUTHORS Joung I, Strominger JL and Shin J. TITLE Molecular cloning of a phosphotyrosine-independent ligand of the p56lck SH2 domain JOURNAL Proc Natl Acad Sci U S A 93 (12), 5991-5995 (1996) PUBMED 8650207 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000219.1. On Mar 19, 2021 this sequence version replaced NM_181550.1. Transcript Variant: This variant (2) lacks several exons and its transcription extends past a splice site that is used in variant 1. This results in a novel 3' coding region and 3' UTR, compared to variant 1. It encodes isoform 2 which is shorter and has a distinct C-terminus, compared to isoform 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF439403.1, DN936437.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-233 JACYVU010000219.1 22569752-22569984 c 234-329 JACYVU010000219.1 22567698-22567793 c 330-556 JACYVU010000219.1 22567230-22567456 c 557-892 JACYVU010000219.1 22566792-22567127 c FEATURES Location/Qualifiers source 1..892 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="10" /map="10q22" gene 1..892 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="sequestosome 1" /db_xref="GeneID:113894" /db_xref="RGD:69287" exon 1..233 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /inference="alignment:Splign:2.1.0" misc_feature 23..25 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="upstream in-frame stop codon" CDS 35..739 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="isoform 2 is encoded by transcript variant 2; oxidative stress induced; protein kinase C-zeta-interacting protein; ubiquitin-binding protein p62; PKC-zeta-interacting protein" /codon_start=1 /product="sequestosome-1 isoform 2" /protein_id="NP_853528.2" /db_xref="GeneID:113894" /db_xref="RGD:69287" /translation="
MASLTVKAYLLGKEEAAREIRRFSFCFSPEPEAEAAAGPGPCERLLSRVAVLFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRREHRPPCAQEARSMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHREHSKLIFPNPFGHLSDSFSHSRWLRKLKHGHFGWPGWEMGPPGNWSPRPPRAGDGRPCPTAESGKAGVCTGFRCHK"
misc_feature 38..178 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="propagated from UniProtKB/Swiss-Prot (O08623.1); Region: Interaction with LCK. /evidence=ECO:0000250|UniProtKB:Q13501" misc_feature 38..40 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="N-acetylalanine. /evidence=ECO:0000250|UniProtKB:Q13501; propagated from UniProtKB/Swiss-Prot (O08623.1); acetylation site" misc_feature 44..334 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="The PB1 domain is an essential part of p62 scaffold protein (alias sequestosome 1,SQSTM) involved in cell signaling, receptor internalization, and protein turnover. The PB1 domain is a modular domain mediating specific protein-protein interaction which...; Region: PB1_p62; cd06402" /db_xref="CDD:99723" misc_feature 104..106 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:Q13501; propagated from UniProtKB/Swiss-Prot (O08623.1); phosphorylation site" misc_feature 155..349 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="propagated from UniProtKB/Swiss-Prot (O08623.1); Region: Interaction with PRKCZ and dimerization. /evidence=ECO:0000269|PubMed:10477520, ECO:0000269|PubMed:12431995" misc_feature 176..268 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="propagated from UniProtKB/Swiss-Prot (O08623.1); Region: Interaction with PAWR. /evidence=ECO:0000250|UniProtKB:Q13501" misc_feature 389..697 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="propagated from UniProtKB/Swiss-Prot (O08623.1); Region: Interaction with GABRR3. /evidence=ECO:0000269|PubMed:12431995" misc_feature 401..523 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears...; Region: ZZ_NBR1_like; cd02340" /db_xref="CDD:239080" misc_feature order(407..409,416..418,449..451,458..460,476..478, 485..487,503..505,512..514) /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="Zinc-binding sites [ion binding]; other site" /db_xref="CDD:239080" misc_feature order(407..409,416..418,476..478,485..487) /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="zinc cluster 1 [ion binding]; other site" /db_xref="CDD:239080" misc_feature order(410..412,440..442,446..448,464..466,470..472) /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="putative charged binding surface [active]" /db_xref="CDD:239080" misc_feature order(449..451,458..460,503..505,512..514) /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="zinc cluster 2 [ion binding]; other site" /db_xref="CDD:239080" misc_feature 467..469 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="Phosphotyrosine. /evidence=ECO:0000250|UniProtKB:Q13501; propagated from UniProtKB/Swiss-Prot (O08623.1); phosphorylation site" misc_feature 533..685 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="propagated from UniProtKB/Swiss-Prot (O08623.1); Region: LIM protein-binding. /evidence=ECO:0000250|UniProtKB:Q13501" misc_feature 551..553 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:Q13501; propagated from UniProtKB/Swiss-Prot (O08623.1); phosphorylation site" misc_feature 557..559 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:Q64337; propagated from UniProtKB/Swiss-Prot (O08623.1); phosphorylation site" misc_feature 644..646 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:Q13501; propagated from UniProtKB/Swiss-Prot (O08623.1); phosphorylation site" exon 234..329 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /inference="alignment:Splign:2.1.0" exon 330..556 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /inference="alignment:Splign:2.1.0" exon 557..892 /gene="Sqstm1" /gene_synonym="Osi; ZIP; ZIP3" /inference="alignment:Splign:2.1.0" ORIGIN
gcccagctgtttcctccgtacctagtctgcggttatggcttcgctcacggtgaaggcctatctactgggcaaggaggaggcggcccgcgagatccgccgcttcagcttctgcttcagcccggagccggaggcggaagccgcggctggcccggggccctgcgagaggctgctgagccgggtggctgtgctgttccccgcgctgcggcctggaggctttcaggcgcactaccgcgatgaggatggggacttggtcgccttctccagtgatgaggaactgacaatggccatgtcctatgtgaaagatgacatcttccgcatctacattaaagagaagaaggagtgccggcgggaacatcgccccccatgtgctcaggaggcacgaagcatggtgcaccccaacgtgatttgtgatggttgcaatgggcctgtggtgggaactcgctataagtgcagtgtgtgccccgactacgacctgtgcagcgtctgcgaggggaagggcctgcacagggagcacagcaagctcatctttcccaacccctttggccacctctctgatagcttctctcatagccgctggcttcggaagctgaaacatgggcactttggctggcctggctgggagatgggcccaccagggaactggagcccacgtcctcctcgcgcaggggatggtcgcccttgccccacagctgagtcgggtaaggctggtgtttgcactggctttaggtgtcataagtagccagcttgttcaggtggacccttggcctaaagtccagaagttcctacaatcagctgtacattacacatccgtttaatttttttggtctttgggggtatggaggttgaacctagggccttgcacataataaataagggctcctttgttgtgcta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]