LOCUS       NM_053602                571 bp    mRNA    linear   ROD 07-MAY-2023
DEFINITION  Rattus norvegicus ATP synthase peripheral stalk subunit F6
            (Atp5pf), mRNA; nuclear gene for mitochondrial product.
ACCESSION   NM_053602
VERSION     NM_053602.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 571)
  AUTHORS   Zhu C, Zhang W, Liu J, Mu B, Zhang F, Lai N, Zhou J, Xu A and Li Y.
  TITLE     Marine collagen peptides reduce endothelial cell injury in diabetic
            rats by inhibiting apoptosis and the expression of coupling factor
            6 and microparticles
  JOURNAL   Mol Med Rep 16 (4), 3947-3957 (2017)
   PUBMED   28731155
REFERENCE   2  (bases 1 to 571)
  AUTHORS   Li N, Yin J, Cai W, Liu J, Zhang N, Yan S, Song L and Li X.
  TITLE     Coupling Factor 6 Is Upregulated in Monocrotaline-induced Pulmonary
            Arterial Hypertension in Rats
  JOURNAL   Am J Med Sci 352 (6), 631-636 (2016)
   PUBMED   27916219
  REMARK    GeneRIF: plasma level increased markedly during pathogenesis of
            pulmonary arterial hypertension (PAH), indicating that CF6 may be
            involved in the development of PAH
REFERENCE   3  (bases 1 to 571)
  AUTHORS   Yin J, You S, Li N, Jiao S, Hu H, Xue M, Wang Y, Cheng W, Liu J, Xu
            M, Yan S and Li X.
  TITLE     Lung-specific RNA interference of coupling factor 6, a novel
            peptide, attenuates pulmonary arterial hypertension in rats
  JOURNAL   Respir Res 17 (1), 99 (2016)
   PUBMED   27491388
  REMARK    GeneRIF: CF6 shRNA effectively inhibited CF6 expression, abolished
            lung macrophage infiltration, reversed endothelial dysfunction and
            vascular remodeling, and ameliorated the severity of pulmonary
            hypertension and right ventricular dysfunction at 4 weeks both as a
            pretreatment and rescue intervention
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 571)
  AUTHORS   He T, Guan A, Shi Y, Ge Z and Dai H.
  TITLE     Mitochondrial coupling factor 6 upregulation in
            hypertension-induced cardiac hypertrophy
  JOURNAL   Herz 40 (5), 783-787 (2015)
   PUBMED   25900768
  REMARK    GeneRIF: CF6 protein was upregulated in cardiac hypertrophy induced
            by hypertension; further mechanisms involved in this process should
            be investigated.
REFERENCE   5  (bases 1 to 571)
  AUTHORS   Ramm S, Morissey B, Hernandez B, Rooney C, Pennington SR and Mally
            A.
  TITLE     Application of a discovery to targeted LC-MS proteomics approach to
            identify deregulated proteins associated with idiosyncratic liver
            toxicity in a rat model of LPS/diclofenac co-administration
  JOURNAL   Toxicology 331, 100-111 (2015)
   PUBMED   25772430
REFERENCE   6  (bases 1 to 571)
  AUTHORS   Osanai T, Kamada T, Fujiwara N, Katoh T, Takahashi K, Kimura M,
            Satoh K, Magota K, Kodama S, Tanaka T and Okumura K.
  TITLE     A novel inhibitory effect on prostacyclin synthesis of coupling
            factor 6 extracted from the heart of spontaneously hypertensive
            rats
  JOURNAL   J Biol Chem 273 (48), 31778-31783 (1998)
   PUBMED   9822642
REFERENCE   7  (bases 1 to 571)
  AUTHORS   Higuti T, Yoshihara Y, Kuroiwa K, Kawamura Y, Toda H and Sakiyama
            F.
  TITLE     A simple, rapid method for purification of epsilon-subunit,
            coupling factor 6, subunit d, and subunit e from rat liver H(+)-ATP
            synthase and determination of the complete amino acid sequence of
            epsilon-subunit
  JOURNAL   J Biol Chem 267 (31), 22658-22661 (1992)
   PUBMED   1429613
REFERENCE   8  (bases 1 to 571)
  AUTHORS   Tracer HL, Loh YP and Birch NP.
  TITLE     Rat mitochondrial coupling factor 6: molecular cloning of a cDNA
            encoding the imported precursor
  JOURNAL   Gene 116 (2), 291-292 (1992)
   PUBMED   1386054
REFERENCE   9  (bases 1 to 571)
  AUTHORS   Yoshihara Y, Nagase H, Yamane T, Oka H, Tani I and Higuti T.
  TITLE     H(+)-ATP synthase from rat liver mitochondria. A simple, rapid
            purification method of the functional complex and its
            characterization
  JOURNAL   Biochemistry 30 (28), 6854-6860 (1991)
   PUBMED   1829963
REFERENCE   10 (bases 1 to 571)
  AUTHORS   Higuti T, Osaka F, Yoshihara Y, Tsurumi C, Kawamura Y, Tani I, Toda
            H, Kakuno T, Sakiyama F, Tanaka K et al.
  TITLE     cDNA cloning and sequencing for the import precursor of coupling
            factor 6 in H(+)-ATP synthase from rat liver mitochondria
  JOURNAL   Biochem Biophys Res Commun 171 (3), 1079-1086 (1990)
   PUBMED   2145831
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from X54510.1.
            
            On Feb 21, 2013 this sequence version replaced NM_053602.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: X54510.1, BG666039.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5756307, SAMEA5760383
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            gene product(s) localized to mito. :: inferred from homology
            RefSeq Select criteria             :: based on conservation,
                                                  expression
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-571               X54510.1           1-571
FEATURES             Location/Qualifiers
     source          1..571
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="11"
                     /map="11q11"
     gene            1..571
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="ATP synthase peripheral stalk subunit F6"
                     /db_xref="GeneID:94271"
                     /db_xref="RGD:621376"
     exon            1..145
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    96..98
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="upstream in-frame stop codon"
     exon            146..325
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /inference="alignment:Splign:2.1.0"
     CDS             162..488
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /EC_number="3.6.1.14"
                     /note="ATP synthase-coupling factor 6, mitochondrial;
                     ATPase subunit F6; ATP synthase, H+ transporting,
                     mitochondrial F0 complex, subunit F6; ATP synthase, H+
                     transporting, mitochondrial Fo complex, subunit F6"
                     /codon_start=1
                     /product="ATP synthase-coupling factor 6, mitochondrial
                     precursor"
                     /protein_id="NP_446054.1"
                     /db_xref="GeneID:94271"
                     /db_xref="RGD:621376"
                     /translation="

MTVQRIFRLSSVLRSAVSVHLRRNIGVTAVAFNKELDPVQKLFLDKIREYKAKRLASGGPVDTGPEYQQEVDRELFKLKQMYGKGEMDKFPTFNFEDPKFEVLDKPQS"

     misc_feature    162..449
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="Mitochondrial ATP synthase coupling factor 6;
                     Region: ATP-synt_F6; pfam05511"
                     /db_xref="CDD:428503"
     transit_peptide 162..257
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="Mitochondrion.
                     /evidence=ECO:0000269|PubMed:1429613; propagated from
                     UniProtKB/Swiss-Prot (P21571.1)"
     mat_peptide     258..485
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /product="ATP synthase-coupling factor 6, mitochondrial"
     misc_feature    282..284
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P18859; propagated from
                     UniProtKB/Swiss-Prot (P21571.1); acetylation site"
     misc_feature    297..299
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P18859; propagated from
                     UniProtKB/Swiss-Prot (P21571.1); acetylation site"
     misc_feature    396..398
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P97450; propagated from
                     UniProtKB/Swiss-Prot (P21571.1); acetylation site"
     misc_feature    411..413
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="N6-acetyllysine, alternate.
                     /evidence=ECO:0000250|UniProtKB:P97450; propagated from
                     UniProtKB/Swiss-Prot (P21571.1); acetylation site"
     misc_feature    456..458
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="N6-acetyllysine, alternate.
                     /evidence=ECO:0000250|UniProtKB:P18859; propagated from
                     UniProtKB/Swiss-Prot (P21571.1); acetylation site"
     misc_feature    474..476
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P18859; propagated from
                     UniProtKB/Swiss-Prot (P21571.1); acetylation site"
     misc_feature    483..485
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (P21571.1); phosphorylation site"
     exon            326..450
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /inference="alignment:Splign:2.1.0"
     exon            451..571
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gcttcctgtccggtgagcgtcgaacgactgaagcggtggcccatagtgcattgcgatggcgggtaggcgtgtgtaggcggagccagggccggaagtagaacggtggcggcggcggtgactctggcagctcgggactcagtgcaagtaccacagactcaaccatgactgttcagaggatcttcaggctctcctctgtccttcggtcagcagtctctgtgcatttgaggaggaacattggtgttacagctgtggcgtttaataaggaacttgatcctgtacagaaactcttcttggacaagataagagagtacaaagcaaagcgactggcgtctggaggacctgttgatactggcccagaatatcagcaagaggtggacagagagctttttaagcttaaacaaatgtatggtaaaggagagatggataagtttcctaccttcaattttgaggatcccaaatttgaagtcctcgacaaaccccagtcctgaggaacatacaaaccatgtggtaatttgtcatgacttagttgtacaattaatctaaaaaattcaaataaacattcacttcacag

//