GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-27 10:39:51, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_053324               1506 bp    mRNA    linear   ROD 22-MAR-2023
DEFINITION  Rattus norvegicus synaptotagmin 9 (Syt9), mRNA.
ACCESSION   NM_053324
VERSION     NM_053324.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1506)
  AUTHORS   Gautam V, D'Avanzo C, Berezovska O, Tanzi RE and Kovacs DM.
  TITLE     Synaptotagmins interact with APP and promote Abeta generation
  JOURNAL   Mol Neurodegener 10, 31 (2015)
   PUBMED   26202512
  REMARK    GeneRIF: Syt-9 regulates endogenous APP-CTF and Abeta levels in
            PC12 cells.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1506)
  AUTHORS   Zhang Z, Wu Y, Wang Z, Dunning FM, Rehfuss J, Ramanan D, Chapman ER
            and Jackson MB.
  TITLE     Release mode of large and small dense-core vesicles specified by
            different synaptotagmin isoforms in PC12 cells
  JOURNAL   Mol Biol Cell 22 (13), 2324-2336 (2011)
   PUBMED   21551071
REFERENCE   3  (bases 1 to 1506)
  AUTHORS   Matsuoka H, Harada K, Nakamura J, Fukuda M and Inoue M.
  TITLE     Differential distribution of synaptotagmin-1, -4, -7, and -9 in rat
            adrenal chromaffin cells
  JOURNAL   Cell Tissue Res 344 (1), 41-50 (2011)
   PUBMED   21287204
  REMARK    GeneRIF: In contrast to PC12 cells and the pancreatic beta cell
            line INS-1, Syt9 was not immunodetected in large dense-core
            vesicles in rat chromaffin cells.
REFERENCE   4  (bases 1 to 1506)
  AUTHORS   Zhang Z, Hui E, Chapman ER and Jackson MB.
  TITLE     Regulation of exocytosis and fusion pores by synaptotagmin-effector
            interactions
  JOURNAL   Mol Biol Cell 21 (16), 2821-2831 (2010)
   PUBMED   20573977
  REMARK    GeneRIF: Data show that Syt I produced more rapid dilation of
            fusion pores than syt VII or syt IX, consistent with its role in
            synchronous synaptic release.
REFERENCE   5  (bases 1 to 1506)
  AUTHORS   Gauthier BR and Wollheim CB.
  TITLE     Synaptotagmins bind calcium to release insulin
  JOURNAL   Am J Physiol Endocrinol Metab 295 (6), E1279-E1286 (2008)
   PUBMED   18713958
  REMARK    Review article
REFERENCE   6  (bases 1 to 1506)
  AUTHORS   Fukuda M.
  TITLE     RNA interference-mediated silencing of synaptotagmin IX, but not
            synaptotagmin I, inhibits dense-core vesicle exocytosis in PC12
            cells
  JOURNAL   Biochem J 380 (Pt 3), 875-879 (2004)
   PUBMED   15015935
REFERENCE   7  (bases 1 to 1506)
  AUTHORS   Tucker WC, Edwardson JM, Bai J, Kim HJ, Martin TF and Chapman ER.
  TITLE     Identification of synaptotagmin effectors via acute inhibition of
            secretion from cracked PC12 cells
  JOURNAL   J Cell Biol 162 (2), 199-209 (2003)
   PUBMED   12860971
REFERENCE   8  (bases 1 to 1506)
  AUTHORS   Fukuda M, Kowalchyk JA, Zhang X, Martin TF and Mikoshiba K.
  TITLE     Synaptotagmin IX regulates Ca2+-dependent secretion in PC12 cells
  JOURNAL   J Biol Chem 277 (7), 4601-4604 (2002)
   PUBMED   11751925
REFERENCE   9  (bases 1 to 1506)
  AUTHORS   Fukuda M, Kanno E and Mikoshiba K.
  TITLE     Conserved N-terminal cysteine motif is essential for homo- and
            heterodimer formation of synaptotagmins III, V, VI, and X
  JOURNAL   J Biol Chem 274 (44), 31421-31427 (1999)
   PUBMED   10531343
REFERENCE   10 (bases 1 to 1506)
  AUTHORS   Li C, Ullrich B, Zhang JZ, Anderson RG, Brose N and Sudhof TC.
  TITLE     Ca(2+)-dependent and -independent activities of neural and
            non-neural synaptotagmins
  JOURNAL   Nature 375 (6532), 594-599 (1995)
   PUBMED   7791877
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF375461.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF375461.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132261, SAMD00132262
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1506
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="1"
                     /map="1q33"
     gene            1..1506
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="synaptotagmin 9"
                     /db_xref="GeneID:60564"
                     /db_xref="RGD:621169"
     CDS             1..1476
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="sytIX; synaptotagmin 5; synaptotagmin V;
                     synaptogamin V; synaptotagmin IX"
                     /codon_start=1
                     /product="synaptotagmin-9"
                     /protein_id="NP_445776.1"
                     /db_xref="GeneID:60564"
                     /db_xref="RGD:621169"
                     /translation="
MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVTACGLALFGVSLFVSWKLCWVPWRERGLFSGSKDNNQEPLNYTDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQPGGQDNCAHAVRVQRQVTEPTPSARHNSIRRQLNLSNPDFNIQQLQRQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVHYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFFDLADFPRECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPESIDQIHLSIAVMDYDRVGHNEVIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWHSLLEKR"
     misc_feature    25..93
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="propagated from UniProtKB/Swiss-Prot (Q925C0.1);
                     Region: Cysteine motif.
                     /evidence=ECO:0000250|UniProtKB:O35681"
     misc_feature    157..219
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="propagated from UniProtKB/Swiss-Prot (Q925C0.1);
                     transmembrane region"
     misc_feature    271..441
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="propagated from UniProtKB/Swiss-Prot (Q925C0.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    529..531
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (Q925C0.1); phosphorylation site"
     misc_feature    661..1035
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="C2 domain; Region: C2; cl14603"
                     /db_xref="CDD:449331"
     misc_feature    1060..1461
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="C2 domain second repeat present in Synaptotagmins
                     3, 5, 6, 9, and 10; Region: C2B_Synaptotagmin-3-5-6-9-10;
                     cd08403"
                     /db_xref="CDD:176048"
     misc_feature    order(1147..1149,1165..1167,1237..1239,1327..1329,
                     1333..1335,1351..1353)
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:176048"
     exon            1..145
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /inference="alignment:Splign:2.1.0"
     exon            146..497
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /inference="alignment:Splign:2.1.0"
     exon            498..1044
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /inference="alignment:Splign:2.1.0"
     exon            1045..1165
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /inference="alignment:Splign:2.1.0"
     exon            1166..1337
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /inference="alignment:Splign:2.1.0"
     exon            1338..1467
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /inference="alignment:Splign:2.1.0"
     exon            1468..1506
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgcccggggccagggacgcgctctgtcaccaggcgctgcagctgctggccgagctctgtgcccgaggggccctggagcacgacagctgccaagatttcatctaccacctgcgggaccgtgccagaccccggctccgcgacccagatatctctgtgagcctgctaactctcgtggttaccgcctgtggtcttgccctctttggtgtctctcttttcgtgtcttggaaactgtgctgggttccgtggcgagagcgaggcctgttctctggtagcaaagacaacaaccaagagcctcttaactacactgatacagagacaaatgagcaggagaacagcgaggacttcctagacccacccacaccctgcccggactcctccatgaagatcagccacacttcccccgacattcccctctccacccagccaggtggccaggacaactgtgcccatgccgtccgtgtacagcgacaagtcacagagccaacgccgtcagctcggcataactcaatccgaagacaactcaacctgtcaaacccggactttaatatccaacagcttcagaggcaggagcagttgactgggattggtagaattaagccagagttatataaacagaggtcactggacaacgacgatgggaggagaagtaacagcaaagcctgcgggaaactgaacttcatcttaaaatacgactgcgacttggaacagctcatcgtgaagatccacaaagccgtcaatctgcccgccaaggacttctctgggacgtcagatccttatgtcaagatctacttgcttcctgaccggaaaacaaaacaccagactaaggttcacaggaagaccctgaaccctgtgtttgacgaggtgtttttatttcctgtgcactacaatgaccttgaagctcggaagcttcacttctccgtgtatgactttgacaggttctctcgccatgacttgattggtcaagtggtggtggaccacttcttcgacttggctgacttccccagggagtgcatcctttggaaggatatcgagtatgtcaccaacgataatgtggacctgggtgagcttatgttttcgctctgctatcttccaacagccggcaggctgaccatcaccatcatcaaagcaaggaatttaaaggcaatggacattacgggagcgtcagatccgtacgtgaaagtctcactgatgtgtgatggccggagactgaagaagaggaaaacatccaccaagaggaacacgcttaaccctgtttacaatgaagccatagtcttcgatgtccctcctgagagcattgatcagatccacttgtccatagctgtcatggactatgaccgtgtaggtcacaatgaggtcatcggcgtgtgccaagtaggcaacgaggctgagcggctgggcagagaccactggagtgagatgctgtcatatccccgaaagcccatcgcacactggcactctctgctggagaaacgatgattgtggataggaagactgcttttgccaagg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]