2024-04-26 19:53:41, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_031059 1894 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus msh homeobox 1 (Msx1), mRNA. ACCESSION NM_031059 VERSION NM_031059.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1894) AUTHORS Nishihara H, Kobayashi N, Kimura-Yoshida C, Yan K, Bormuth O, Ding Q, Nakanishi A, Sasaki T, Hirakawa M, Sumiyama K, Furuta Y, Tarabykin V, Matsuo I and Okada N. TITLE Coordinately Co-opted Multiple Transposable Elements Constitute an Enhancer for wnt5a Expression in the Mammalian Secondary Palate JOURNAL PLoS Genet 12 (10), e1006380 (2016) PUBMED 27741242 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1894) AUTHORS Le Bouffant R, Souquet B, Duval N, Duquenne C, Herve R, Frydman N, Robert B, Habert R and Livera G. TITLE Msx1 and Msx2 promote meiosis initiation JOURNAL Development 138 (24), 5393-5402 (2011) PUBMED 22071108 REFERENCE 3 (bases 1 to 1894) AUTHORS Bensoussan-Trigano V, Lallemand Y, Saint Cloment C and Robert B. TITLE Msx1 and Msx2 in limb mesenchyme modulate digit number and identity JOURNAL Dev Dyn 240 (5), 1190-1202 (2011) PUBMED 21465616 REFERENCE 4 (bases 1 to 1894) AUTHORS Nakatomi M, Wang XP, Key D, Lund JJ, Turbe-Doan A, Kist R, Aw A, Chen Y, Maas RL and Peters H. TITLE Genetic interactions between Pax9 and Msx1 regulate lip development and several stages of tooth morphogenesis JOURNAL Dev Biol 340 (2), 438-449 (2010) PUBMED 20123092 REFERENCE 5 (bases 1 to 1894) AUTHORS Zhou X, Sheng Y, Yang R and Kong X. TITLE Nicotine promotes cardiomyocyte apoptosis via oxidative stress and altered apoptosis-related gene expression JOURNAL Cardiology 115 (4), 243-250 (2010) PUBMED 20339300 REFERENCE 6 (bases 1 to 1894) AUTHORS Iler N and Abate-Shen C. TITLE Rapid identification of homeodomain binding sites in the Wnt-5a gene using an immunoprecipitation strategy JOURNAL Biochem Biophys Res Commun 227 (1), 257-265 (1996) PUBMED 8858134 REFERENCE 7 (bases 1 to 1894) AUTHORS Chen Y, Bei M, Woo I, Satokata I and Maas R. TITLE Msx1 controls inductive signaling in mammalian tooth morphogenesis JOURNAL Development 122 (10), 3035-3044 (1996) PUBMED 8898217 REFERENCE 8 (bases 1 to 1894) AUTHORS Vastardis H, Karimbux N, Guthua SW, Seidman JG and Seidman CE. TITLE A human MSX1 homeodomain missense mutation causes selective tooth agenesis JOURNAL Nat Genet 13 (4), 417-421 (1996) PUBMED 8696335 REFERENCE 9 (bases 1 to 1894) AUTHORS Catron KM, Wang H, Hu G, Shen MM and Abate-Shen C. TITLE Comparison of MSX-1 and MSX-2 suggests a molecular basis for functional redundancy JOURNAL Mech Dev 55 (2), 185-199 (1996) PUBMED 8861098 REMARK Erratum:[Mech Dev 1996 May;56(1-2):223] REFERENCE 10 (bases 1 to 1894) AUTHORS Kuzuoka M, Takahashi T, Guron C and Raghow R. TITLE Murine homeobox-containing gene, Msx-1: analysis of genomic organization, promoter structure, and potential autoregulatory cis-acting elements JOURNAL Genomics 21 (1), 85-91 (1994) PUBMED 7916326 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000254.1 and D83036.1. On Mar 5, 2021 this sequence version replaced NM_031059.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: D83036.1, SRR8487227.228844.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132292, SAMD00155320 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-553 JACYVU010000254.1 26662374-26662926 554-969 D83036.1 450-865 970-1894 JACYVU010000254.1 26665384-26666308 FEATURES Location/Qualifiers source 1..1894 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="14" /map="14q21" gene 1..1894 /gene="Msx1" /note="msh homeobox 1" /db_xref="GeneID:81710" /db_xref="RGD:620929" exon 1..696 /gene="Msx1" /inference="alignment:Splign:2.1.0" misc_feature 180..182 /gene="Msx1" /note="upstream in-frame stop codon" CDS 228..1139 /gene="Msx1" /note="homeo box, msh-like 1" /codon_start=1 /product="homeobox protein MSX-1" /protein_id="NP_112321.2" /db_xref="GeneID:81710" /db_xref="RGD:620929" /translation="
MAPAAAMTSLPLGVKVEDSAFAKPAGGGAGQAPGAAAATATAMGTDEEGAKPKVPASLLPFSVEALMADHRKPGAKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPGPLGHFSVGGLLKLPEDALVKAESPEKLDRTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYSASGPFQRAALPVAPVGLYTAHVGYSMYHLT"
misc_feature order(744..758,762..764,813..815,831..833,870..872, 876..881,888..893,897..905,909..914) /gene="Msx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 750..911 /gene="Msx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(750..752,759..761,879..881,888..893,900..902) /gene="Msx1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 697..1894 /gene="Msx1" /inference="alignment:Splign:2.1.0" ORIGIN
ggacccggagccggcgagtgcgcccgggaactcggcctgcgcggcgcagggatccaggcccagctcgctggagttggccttccagggaagctgcaggagactcgcgcgcgacagcgggccggaccagatccctgggagctcacagaagccggccgcgctcccagcccgcccgaaacccatgatccaggctggcccgagctgcggctggagtgggggtccggctctgcatggccccggctgctgctatgacttctttgccactcggtgtcaaagtggaggactccgccttcgccaagcctgctgggggaggcgctggccaggcccccggggctgctgcggccactgcaaccgccatgggcacagatgaggagggggccaagcccaaagtgcccgcttcactcctgcccttcagcgtggaggccctcatggccgatcacaggaagcccggggcaaaggagagcgtcctggtggcttccgaaggggctcaggcggcgggtggctcggtgcagcacttgggcacccggcccgggtctctgggcgccccggacgcgccctcctcgccggggcctctcggccatttctctgttgggggactcctcaagctgccagaagatgctctggtgaaggccgagagcccggagaagctagatcggaccccgtggatgcagagtccccgcttctccccgcccccagccaggcggctgagtcccccggcctgcaccctacgcaagcacaagaccaaccgcaagcccaggacgcccttcaccacggctcagctactggctctggagcgcaagttccgccagaagcagtacctgtctattgccgagcgcgccgagttctccagctcgctcagccttaccgagacccaggtgaagatctggttccagaaccgccgtgctaaggccaagagactgcaggaggccgagttggagaagttgaagatggccgcgaagccaatgttgccgcctgcggccttcggcctctcctttcctcttggtggccctgcagcggtggctgcagctgccggcgcctcactctacagtgcctctggccctttccagcgcgccgcgctgcctgtagcgccggtgggactctacaccgcccacgtaggctacagcatgtaccacctgacataggtgggcccagagtcacctccctgtggtgccatcccttcccccagccacctcttctagcagcgggagtccttcctaggaagctcggctgcccaacaccacctggccccttctcttaaacccttcgctacacagttcctcctggccatcgcatctaaagttcctcctccctcttccgaccccttctgggaagaaaaaaaagtggccggaagtgtctaggtttttcgagaaaaatttatatttacacgtgcgagttataaatgtggaaactgggggatgcaaaggcgaagagatttatccgtggtccccagcagaattagaagctgaaggagaccagaggccaaaaggactagaggccatgagactcccatcagctgcttccggtcctgaaaccaggcaggacttgcacagagaaattgttatttggtgcttcaagagacgagcccagccctatagaaagcaaggagcacagctccttccactgtcagactccaaacgctttgcagcaaagcattgctctgagggggcagggtgcgtgctggtgcttcacgaaggtaggttgaagagactttcccaggaccagaaaaaaaagaagttaaaaaaacaaaatctgtttctatttaacagtacattttcgtggctctcaaacatcccttttgaagggatcgtgtgtactatgtaatatactgtatatttgaaattttattatcatttatattatagctatatttgttaaataaattaattttaagctacaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]