GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-26 19:53:41, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_031059               1894 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus msh homeobox 1 (Msx1), mRNA.
ACCESSION   NM_031059
VERSION     NM_031059.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1894)
  AUTHORS   Nishihara H, Kobayashi N, Kimura-Yoshida C, Yan K, Bormuth O, Ding
            Q, Nakanishi A, Sasaki T, Hirakawa M, Sumiyama K, Furuta Y,
            Tarabykin V, Matsuo I and Okada N.
  TITLE     Coordinately Co-opted Multiple Transposable Elements Constitute an
            Enhancer for wnt5a Expression in the Mammalian Secondary Palate
  JOURNAL   PLoS Genet 12 (10), e1006380 (2016)
   PUBMED   27741242
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1894)
  AUTHORS   Le Bouffant R, Souquet B, Duval N, Duquenne C, Herve R, Frydman N,
            Robert B, Habert R and Livera G.
  TITLE     Msx1 and Msx2 promote meiosis initiation
  JOURNAL   Development 138 (24), 5393-5402 (2011)
   PUBMED   22071108
REFERENCE   3  (bases 1 to 1894)
  AUTHORS   Bensoussan-Trigano V, Lallemand Y, Saint Cloment C and Robert B.
  TITLE     Msx1 and Msx2 in limb mesenchyme modulate digit number and identity
  JOURNAL   Dev Dyn 240 (5), 1190-1202 (2011)
   PUBMED   21465616
REFERENCE   4  (bases 1 to 1894)
  AUTHORS   Nakatomi M, Wang XP, Key D, Lund JJ, Turbe-Doan A, Kist R, Aw A,
            Chen Y, Maas RL and Peters H.
  TITLE     Genetic interactions between Pax9 and Msx1 regulate lip development
            and several stages of tooth morphogenesis
  JOURNAL   Dev Biol 340 (2), 438-449 (2010)
   PUBMED   20123092
REFERENCE   5  (bases 1 to 1894)
  AUTHORS   Zhou X, Sheng Y, Yang R and Kong X.
  TITLE     Nicotine promotes cardiomyocyte apoptosis via oxidative stress and
            altered apoptosis-related gene expression
  JOURNAL   Cardiology 115 (4), 243-250 (2010)
   PUBMED   20339300
REFERENCE   6  (bases 1 to 1894)
  AUTHORS   Iler N and Abate-Shen C.
  TITLE     Rapid identification of homeodomain binding sites in the Wnt-5a
            gene using an immunoprecipitation strategy
  JOURNAL   Biochem Biophys Res Commun 227 (1), 257-265 (1996)
   PUBMED   8858134
REFERENCE   7  (bases 1 to 1894)
  AUTHORS   Chen Y, Bei M, Woo I, Satokata I and Maas R.
  TITLE     Msx1 controls inductive signaling in mammalian tooth morphogenesis
  JOURNAL   Development 122 (10), 3035-3044 (1996)
   PUBMED   8898217
REFERENCE   8  (bases 1 to 1894)
  AUTHORS   Vastardis H, Karimbux N, Guthua SW, Seidman JG and Seidman CE.
  TITLE     A human MSX1 homeodomain missense mutation causes selective tooth
            agenesis
  JOURNAL   Nat Genet 13 (4), 417-421 (1996)
   PUBMED   8696335
REFERENCE   9  (bases 1 to 1894)
  AUTHORS   Catron KM, Wang H, Hu G, Shen MM and Abate-Shen C.
  TITLE     Comparison of MSX-1 and MSX-2 suggests a molecular basis for
            functional redundancy
  JOURNAL   Mech Dev 55 (2), 185-199 (1996)
   PUBMED   8861098
  REMARK    Erratum:[Mech Dev 1996 May;56(1-2):223]
REFERENCE   10 (bases 1 to 1894)
  AUTHORS   Kuzuoka M, Takahashi T, Guron C and Raghow R.
  TITLE     Murine homeobox-containing gene, Msx-1: analysis of genomic
            organization, promoter structure, and potential autoregulatory
            cis-acting elements
  JOURNAL   Genomics 21 (1), 85-91 (1994)
   PUBMED   7916326
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000254.1 and D83036.1.
            
            On Mar 5, 2021 this sequence version replaced NM_031059.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: D83036.1, SRR8487227.228844.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132292, SAMD00155320
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-553               JACYVU010000254.1  26662374-26662926
            554-969             D83036.1           450-865
            970-1894            JACYVU010000254.1  26665384-26666308
FEATURES             Location/Qualifiers
     source          1..1894
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="14"
                     /map="14q21"
     gene            1..1894
                     /gene="Msx1"
                     /note="msh homeobox 1"
                     /db_xref="GeneID:81710"
                     /db_xref="RGD:620929"
     exon            1..696
                     /gene="Msx1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    180..182
                     /gene="Msx1"
                     /note="upstream in-frame stop codon"
     CDS             228..1139
                     /gene="Msx1"
                     /note="homeo box, msh-like 1"
                     /codon_start=1
                     /product="homeobox protein MSX-1"
                     /protein_id="NP_112321.2"
                     /db_xref="GeneID:81710"
                     /db_xref="RGD:620929"
                     /translation="
MAPAAAMTSLPLGVKVEDSAFAKPAGGGAGQAPGAAAATATAMGTDEEGAKPKVPASLLPFSVEALMADHRKPGAKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPGPLGHFSVGGLLKLPEDALVKAESPEKLDRTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYSASGPFQRAALPVAPVGLYTAHVGYSMYHLT"
     misc_feature    order(744..758,762..764,813..815,831..833,870..872,
                     876..881,888..893,897..905,909..914)
                     /gene="Msx1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    750..911
                     /gene="Msx1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(750..752,759..761,879..881,888..893,900..902)
                     /gene="Msx1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            697..1894
                     /gene="Msx1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ggacccggagccggcgagtgcgcccgggaactcggcctgcgcggcgcagggatccaggcccagctcgctggagttggccttccagggaagctgcaggagactcgcgcgcgacagcgggccggaccagatccctgggagctcacagaagccggccgcgctcccagcccgcccgaaacccatgatccaggctggcccgagctgcggctggagtgggggtccggctctgcatggccccggctgctgctatgacttctttgccactcggtgtcaaagtggaggactccgccttcgccaagcctgctgggggaggcgctggccaggcccccggggctgctgcggccactgcaaccgccatgggcacagatgaggagggggccaagcccaaagtgcccgcttcactcctgcccttcagcgtggaggccctcatggccgatcacaggaagcccggggcaaaggagagcgtcctggtggcttccgaaggggctcaggcggcgggtggctcggtgcagcacttgggcacccggcccgggtctctgggcgccccggacgcgccctcctcgccggggcctctcggccatttctctgttgggggactcctcaagctgccagaagatgctctggtgaaggccgagagcccggagaagctagatcggaccccgtggatgcagagtccccgcttctccccgcccccagccaggcggctgagtcccccggcctgcaccctacgcaagcacaagaccaaccgcaagcccaggacgcccttcaccacggctcagctactggctctggagcgcaagttccgccagaagcagtacctgtctattgccgagcgcgccgagttctccagctcgctcagccttaccgagacccaggtgaagatctggttccagaaccgccgtgctaaggccaagagactgcaggaggccgagttggagaagttgaagatggccgcgaagccaatgttgccgcctgcggccttcggcctctcctttcctcttggtggccctgcagcggtggctgcagctgccggcgcctcactctacagtgcctctggccctttccagcgcgccgcgctgcctgtagcgccggtgggactctacaccgcccacgtaggctacagcatgtaccacctgacataggtgggcccagagtcacctccctgtggtgccatcccttcccccagccacctcttctagcagcgggagtccttcctaggaagctcggctgcccaacaccacctggccccttctcttaaacccttcgctacacagttcctcctggccatcgcatctaaagttcctcctccctcttccgaccccttctgggaagaaaaaaaagtggccggaagtgtctaggtttttcgagaaaaatttatatttacacgtgcgagttataaatgtggaaactgggggatgcaaaggcgaagagatttatccgtggtccccagcagaattagaagctgaaggagaccagaggccaaaaggactagaggccatgagactcccatcagctgcttccggtcctgaaaccaggcaggacttgcacagagaaattgttatttggtgcttcaagagacgagcccagccctatagaaagcaaggagcacagctccttccactgtcagactccaaacgctttgcagcaaagcattgctctgagggggcagggtgcgtgctggtgcttcacgaaggtaggttgaagagactttcccaggaccagaaaaaaaagaagttaaaaaaacaaaatctgtttctatttaacagtacattttcgtggctctcaaacatcccttttgaagggatcgtgtgtactatgtaatatactgtatatttgaaattttattatcatttatattatagctatatttgttaaataaattaattttaagctacaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]