2024-04-26 06:53:43, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_022852 1406 bp mRNA linear ROD 11-JUN-2023 DEFINITION Rattus norvegicus pancreatic and duodenal homeobox 1 (Pdx1), mRNA. ACCESSION NM_022852 VERSION NM_022852.4 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1406) AUTHORS Sharma R, Maity SK, Chakrabarti P, Katika MR, Kapettu S, Parsa KVL and Misra P. TITLE PIMT Controls Insulin Synthesis and Secretion through PDX1 JOURNAL Int J Mol Sci 24 (9), 8084 (2023) PUBMED 37175791 REMARK GeneRIF: PIMT Controls Insulin Synthesis and Secretion through PDX1. Publication Status: Online-Only REFERENCE 2 (bases 1 to 1406) AUTHORS Zhang M, Yang C, Zhu M, Qian L, Luo Y, Cheng H, Geng R, Xu X, Qian C and Liu Y. TITLE Saturated fatty acids entrap PDX1 in stress granules and impede islet beta cell function JOURNAL Diabetologia 64 (5), 1144-1157 (2021) PUBMED 33569632 REMARK GeneRIF: Saturated fatty acids entrap PDX1 in stress granules and impede islet beta cell function. REFERENCE 3 (bases 1 to 1406) AUTHORS Yao X, Li K, Liang C, Zhou Z, Wang J, Wang S, Liu L, Yu CL, Song ZB, Bao YL, Zheng LH, Sun Y, Wang G, Huang Y, Yi J, Sun L and Li Y. TITLE Tectorigenin enhances PDX1 expression and protects pancreatic beta-cells by activating ERK and reducing ER stress JOURNAL J Biol Chem 295 (37), 12975-12992 (2020) PUBMED 32690606 REMARK GeneRIF: Tectorigenin enhances PDX1 expression and protects pancreatic beta-cells by activating ERK and reducing ER stress. REFERENCE 4 (bases 1 to 1406) AUTHORS Mahdipour E, Salmasi Z and Sabeti N. TITLE Potential of stem cell-derived exosomes to regenerate beta islets through Pdx-1 dependent mechanism in a rat model of type 1 diabetes JOURNAL J Cell Physiol 234 (11), 20310-20321 (2019) PUBMED 30997693 REMARK GeneRIF: that exosomes induce the islet regeneration through pancreatic and duodenal homeobox 1 pathway REFERENCE 5 (bases 1 to 1406) AUTHORS Liang C, Hao F, Yao X, Qiu Y, Liu L, Wang S, Yu C, Song Z, Bao Y, Yi J, Huang Y, Wu Y, Zheng L, Sun Y, Wang G, Yang X, Yang S, Sun L and Li Y. TITLE Hypericin maintians PDX1 expression via the Erk pathway and protects islet beta-cells against glucotoxicity and lipotoxicity JOURNAL Int J Biol Sci 15 (7), 1472-1487 (2019) PUBMED 31337977 REMARK GeneRIF: PDX1 expression is maintained via the Erk pathway and protects islet beta-cells against glucotoxicity and lipotoxicity Publication Status: Online-Only REFERENCE 6 (bases 1 to 1406) AUTHORS Sharma S, Leonard J, Lee S, Chapman HD, Leiter EH and Montminy MR. TITLE Pancreatic islet expression of the homeobox factor STF-1 relies on an E-box motif that binds USF JOURNAL J Biol Chem 271 (4), 2294-2299 (1996) PUBMED 8567692 REFERENCE 7 (bases 1 to 1406) AUTHORS Peers B, Sharma S, Johnson T, Kamps M and Montminy M. TITLE The pancreatic islet factor STF-1 binds cooperatively with Pbx to a regulatory element in the somatostatin promoter: importance of the FPWMK motif and of the homeodomain JOURNAL Mol Cell Biol 15 (12), 7091-7097 (1995) PUBMED 8524276 REFERENCE 8 (bases 1 to 1406) AUTHORS Miller CP, McGehee RE Jr and Habener JF. TITLE IDX-1: a new homeodomain transcription factor expressed in rat pancreatic islets and duodenum that transactivates the somatostatin gene JOURNAL EMBO J 13 (5), 1145-1156 (1994) PUBMED 7907546 REFERENCE 9 (bases 1 to 1406) AUTHORS Leonard J, Peers B, Johnson T, Ferreri K, Lee S and Montminy MR. TITLE Characterization of somatostatin transactivating factor-1, a novel homeobox factor that stimulates somatostatin expression in pancreatic islet cells JOURNAL Mol Endocrinol 7 (10), 1275-1283 (1993) PUBMED 7505393 REFERENCE 10 (bases 1 to 1406) AUTHORS Kerckaert,J.P., Bayard,B., Debray,H., Sautiere,P. and Biserte,G. TITLE Rat alpha-fetoprotein heterogeneity. Comparative chemical study of the two electrophoretic variants and their Ricinus lectin-binding properties JOURNAL Biochim Biophys Acta 493 (2), 293-303 (1977) PUBMED 70227 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000224.1. On Nov 20, 2020 this sequence version replaced NM_022852.3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: U04833.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5756307 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-531 JACYVU010000224.1 3729105-3729635 c 532-1406 JACYVU010000224.1 3724436-3725310 c FEATURES Location/Qualifiers source 1..1406 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="12" /map="12p11" gene 1..1406 /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /note="pancreatic and duodenal homeobox 1" /db_xref="GeneID:29535" /db_xref="RGD:62387" exon 1..531 /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /inference="alignment:Splign:2.1.0" misc_feature 66..68 /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /note="upstream in-frame stop codon" CDS 126..977 /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /function="transcription factor" /note="islet/duodenum homeobox-1; somatostatin transactivating factor 1; IDX-1; IPF-1; STF-1; Insulin promoter factor 1; insulin promotor factor 1; pancreatic and duodenal homeobox gene 1" /codon_start=1 /product="pancreas/duodenum homeobox protein 1" /protein_id="NP_074043.4" /db_xref="GeneID:29535" /db_xref="RGD:62387" /translation="
MNSEEQYYAATQLYKDPCAFQRGPVPEFSANPPACLYMGRQPPPPPPPQFAGSLGTLEQGSPPDISPYEVPPLADDPAGAHLHHHLPAQLGLAHPPPGPFPNGTETGGLEEPSRVHLPFPWMKSTKAHAWKSQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTTSGGGGGEEPEQDCAVTSGEELLALPPPPPPGGAVPSGVPAAAREGRLPSGLSASPQPSSIAPLRPQEPR"
misc_feature 162..344 /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /note="propagated from UniProtKB/Swiss-Prot (P52947.1); Region: Transactivation domain" misc_feature 231..368 /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /note="propagated from UniProtKB/Swiss-Prot (P52947.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 477..494 /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /note="propagated from UniProtKB/Swiss-Prot (P52947.1); Region: Antp-type hexapeptide" misc_feature order(564..578,582..584,633..635,651..653,690..692, 696..701,708..713,717..725,729..734) /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 570..731 /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(570..572,579..581,699..701,708..713,720..722) /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 576..578 /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /note="Phosphothreonine, by PASK. /evidence=ECO:0000250|UniProtKB:P52946; propagated from UniProtKB/Swiss-Prot (P52947.1); phosphorylation site" misc_feature 714..734 /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /note="propagated from UniProtKB/Swiss-Prot (P52947.1); Region: Nuclear localization signal. /evidence=ECO:0000250" misc_feature 726..974 /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /note="propagated from UniProtKB/Swiss-Prot (P52947.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 927..929 /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (P52947.1); phosphorylation site" exon 532..1406 /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /inference="alignment:Splign:2.1.0" ORIGIN
agagcagtggagaactgtcaaagcgatctggggtggcgctgagagtccgtgagctgcccagcgcctaaggcctggcttgtagctccctaccccgggctgccggccccgaagtgccggctgccaccatgaatagtgaggagcagtactacgcggccacacagctctacaaggacccgtgcgcattccagaggggtccggtgccagagttcagtgctaatccccctgcgtgcctgtacatgggccgccagcccccacctccgccgccaccccagtttgcaggctcgctgggaacgctggaacagggaagtcccccggacatctccccatacgaagtgcccccgctcgccgatgacccggctggcgcgcacctccaccaccacctcccagctcagctcgggctcgcccatccacctcccggacctttcccgaatggaaccgagactgggggcctggaagagcccagccgcgttcatctccctttcccgtggatgaaatccaccaaagctcacgcgtggaaaagccagtgggcaggaggtgcatacgcagcagaaccggaggagaataagaggacccgtacagcctacactcgggcccagctgctggagctggagaaggaattcttatttaacaaatacatctcccggcctcgccgggtggagctggcagtgatgctcaacttgactgagagacacatcaaaatctggttccaaaaccgtcgcatgaagtggaagaaagaggaagataagaaacgtagtagcgggacaacgagcgggggcggtgggggcgaagagccggagcaggattgtgccgtaacctcgggcgaggagctgctggcattgccaccgccaccacctcccggaggtgctgtgccctcaggcgtccctgctgctgcccgggagggccgactgccttccggccttagtgcgtccccacagccctccagcatcgcgccactgcgaccgcaggaaccccggtgaggaccgcaggctgagggtgagcgggtctgggacccagagtgcggacatgggcatgggcccgggcagctggataagggaggggatcatgaggcttaacctaaacgccacacaaggagaacattcttcttgggggcacaagagccagttgggtatagccagcgagatgctggcagacctctgggaaaaaaaaagacccgagcttctgaaaactttgaggctgcctctcgtgccatgtgaaccgccaggtctgcctctgggactctttcctgggaccaatttagagaatcaggctcccaactgaggacaatgaaaaggttacaaacttgagcggtcccataacagccaccaggcgagctggaccgggtgcctttgactggtcggccgagcaatctaaggttgagaataaagggagctgtttgaggtttcaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]