GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-26 06:53:43, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_022852               1406 bp    mRNA    linear   ROD 11-JUN-2023
DEFINITION  Rattus norvegicus pancreatic and duodenal homeobox 1 (Pdx1), mRNA.
ACCESSION   NM_022852
VERSION     NM_022852.4
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1406)
  AUTHORS   Sharma R, Maity SK, Chakrabarti P, Katika MR, Kapettu S, Parsa KVL
            and Misra P.
  TITLE     PIMT Controls Insulin Synthesis and Secretion through PDX1
  JOURNAL   Int J Mol Sci 24 (9), 8084 (2023)
   PUBMED   37175791
  REMARK    GeneRIF: PIMT Controls Insulin Synthesis and Secretion through
            PDX1.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1406)
  AUTHORS   Zhang M, Yang C, Zhu M, Qian L, Luo Y, Cheng H, Geng R, Xu X, Qian
            C and Liu Y.
  TITLE     Saturated fatty acids entrap PDX1 in stress granules and impede
            islet beta cell function
  JOURNAL   Diabetologia 64 (5), 1144-1157 (2021)
   PUBMED   33569632
  REMARK    GeneRIF: Saturated fatty acids entrap PDX1 in stress granules and
            impede islet beta cell function.
REFERENCE   3  (bases 1 to 1406)
  AUTHORS   Yao X, Li K, Liang C, Zhou Z, Wang J, Wang S, Liu L, Yu CL, Song
            ZB, Bao YL, Zheng LH, Sun Y, Wang G, Huang Y, Yi J, Sun L and Li Y.
  TITLE     Tectorigenin enhances PDX1 expression and protects pancreatic
            beta-cells by activating ERK and reducing ER stress
  JOURNAL   J Biol Chem 295 (37), 12975-12992 (2020)
   PUBMED   32690606
  REMARK    GeneRIF: Tectorigenin enhances PDX1 expression and protects
            pancreatic beta-cells by activating ERK and reducing ER stress.
REFERENCE   4  (bases 1 to 1406)
  AUTHORS   Mahdipour E, Salmasi Z and Sabeti N.
  TITLE     Potential of stem cell-derived exosomes to regenerate beta islets
            through Pdx-1 dependent mechanism in a rat model of type 1 diabetes
  JOURNAL   J Cell Physiol 234 (11), 20310-20321 (2019)
   PUBMED   30997693
  REMARK    GeneRIF: that exosomes induce the islet regeneration through
            pancreatic and duodenal homeobox 1 pathway
REFERENCE   5  (bases 1 to 1406)
  AUTHORS   Liang C, Hao F, Yao X, Qiu Y, Liu L, Wang S, Yu C, Song Z, Bao Y,
            Yi J, Huang Y, Wu Y, Zheng L, Sun Y, Wang G, Yang X, Yang S, Sun L
            and Li Y.
  TITLE     Hypericin maintians PDX1 expression via the Erk pathway and
            protects islet beta-cells against glucotoxicity and lipotoxicity
  JOURNAL   Int J Biol Sci 15 (7), 1472-1487 (2019)
   PUBMED   31337977
  REMARK    GeneRIF: PDX1 expression is maintained via the Erk pathway and
            protects islet beta-cells against glucotoxicity and lipotoxicity
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1406)
  AUTHORS   Sharma S, Leonard J, Lee S, Chapman HD, Leiter EH and Montminy MR.
  TITLE     Pancreatic islet expression of the homeobox factor STF-1 relies on
            an E-box motif that binds USF
  JOURNAL   J Biol Chem 271 (4), 2294-2299 (1996)
   PUBMED   8567692
REFERENCE   7  (bases 1 to 1406)
  AUTHORS   Peers B, Sharma S, Johnson T, Kamps M and Montminy M.
  TITLE     The pancreatic islet factor STF-1 binds cooperatively with Pbx to a
            regulatory element in the somatostatin promoter: importance of the
            FPWMK motif and of the homeodomain
  JOURNAL   Mol Cell Biol 15 (12), 7091-7097 (1995)
   PUBMED   8524276
REFERENCE   8  (bases 1 to 1406)
  AUTHORS   Miller CP, McGehee RE Jr and Habener JF.
  TITLE     IDX-1: a new homeodomain transcription factor expressed in rat
            pancreatic islets and duodenum that transactivates the somatostatin
            gene
  JOURNAL   EMBO J 13 (5), 1145-1156 (1994)
   PUBMED   7907546
REFERENCE   9  (bases 1 to 1406)
  AUTHORS   Leonard J, Peers B, Johnson T, Ferreri K, Lee S and Montminy MR.
  TITLE     Characterization of somatostatin transactivating factor-1, a novel
            homeobox factor that stimulates somatostatin expression in
            pancreatic islet cells
  JOURNAL   Mol Endocrinol 7 (10), 1275-1283 (1993)
   PUBMED   7505393
REFERENCE   10 (bases 1 to 1406)
  AUTHORS   Kerckaert,J.P., Bayard,B., Debray,H., Sautiere,P. and Biserte,G.
  TITLE     Rat alpha-fetoprotein heterogeneity. Comparative chemical study of
            the two electrophoretic variants and their Ricinus lectin-binding
            properties
  JOURNAL   Biochim Biophys Acta 493 (2), 293-303 (1977)
   PUBMED   70227
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000224.1.
            
            On Nov 20, 2020 this sequence version replaced NM_022852.3.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U04833.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5756307 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-531               JACYVU010000224.1  3729105-3729635     c
            532-1406            JACYVU010000224.1  3724436-3725310     c
FEATURES             Location/Qualifiers
     source          1..1406
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="12"
                     /map="12p11"
     gene            1..1406
                     /gene="Pdx1"
                     /gene_synonym="Idx1; Ipf1; Stf1"
                     /note="pancreatic and duodenal homeobox 1"
                     /db_xref="GeneID:29535"
                     /db_xref="RGD:62387"
     exon            1..531
                     /gene="Pdx1"
                     /gene_synonym="Idx1; Ipf1; Stf1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    66..68
                     /gene="Pdx1"
                     /gene_synonym="Idx1; Ipf1; Stf1"
                     /note="upstream in-frame stop codon"
     CDS             126..977
                     /gene="Pdx1"
                     /gene_synonym="Idx1; Ipf1; Stf1"
                     /function="transcription factor"
                     /note="islet/duodenum homeobox-1; somatostatin
                     transactivating factor 1; IDX-1; IPF-1; STF-1; Insulin
                     promoter factor 1; insulin promotor factor 1; pancreatic
                     and duodenal homeobox gene 1"
                     /codon_start=1
                     /product="pancreas/duodenum homeobox protein 1"
                     /protein_id="NP_074043.4"
                     /db_xref="GeneID:29535"
                     /db_xref="RGD:62387"
                     /translation="
MNSEEQYYAATQLYKDPCAFQRGPVPEFSANPPACLYMGRQPPPPPPPQFAGSLGTLEQGSPPDISPYEVPPLADDPAGAHLHHHLPAQLGLAHPPPGPFPNGTETGGLEEPSRVHLPFPWMKSTKAHAWKSQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTTSGGGGGEEPEQDCAVTSGEELLALPPPPPPGGAVPSGVPAAAREGRLPSGLSASPQPSSIAPLRPQEPR"
     misc_feature    162..344
                     /gene="Pdx1"
                     /gene_synonym="Idx1; Ipf1; Stf1"
                     /note="propagated from UniProtKB/Swiss-Prot (P52947.1);
                     Region: Transactivation domain"
     misc_feature    231..368
                     /gene="Pdx1"
                     /gene_synonym="Idx1; Ipf1; Stf1"
                     /note="propagated from UniProtKB/Swiss-Prot (P52947.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    477..494
                     /gene="Pdx1"
                     /gene_synonym="Idx1; Ipf1; Stf1"
                     /note="propagated from UniProtKB/Swiss-Prot (P52947.1);
                     Region: Antp-type hexapeptide"
     misc_feature    order(564..578,582..584,633..635,651..653,690..692,
                     696..701,708..713,717..725,729..734)
                     /gene="Pdx1"
                     /gene_synonym="Idx1; Ipf1; Stf1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    570..731
                     /gene="Pdx1"
                     /gene_synonym="Idx1; Ipf1; Stf1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(570..572,579..581,699..701,708..713,720..722)
                     /gene="Pdx1"
                     /gene_synonym="Idx1; Ipf1; Stf1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    576..578
                     /gene="Pdx1"
                     /gene_synonym="Idx1; Ipf1; Stf1"
                     /note="Phosphothreonine, by PASK.
                     /evidence=ECO:0000250|UniProtKB:P52946; propagated from
                     UniProtKB/Swiss-Prot (P52947.1); phosphorylation site"
     misc_feature    714..734
                     /gene="Pdx1"
                     /gene_synonym="Idx1; Ipf1; Stf1"
                     /note="propagated from UniProtKB/Swiss-Prot (P52947.1);
                     Region: Nuclear localization signal.
                     /evidence=ECO:0000250"
     misc_feature    726..974
                     /gene="Pdx1"
                     /gene_synonym="Idx1; Ipf1; Stf1"
                     /note="propagated from UniProtKB/Swiss-Prot (P52947.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    927..929
                     /gene="Pdx1"
                     /gene_synonym="Idx1; Ipf1; Stf1"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (P52947.1); phosphorylation site"
     exon            532..1406
                     /gene="Pdx1"
                     /gene_synonym="Idx1; Ipf1; Stf1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agagcagtggagaactgtcaaagcgatctggggtggcgctgagagtccgtgagctgcccagcgcctaaggcctggcttgtagctccctaccccgggctgccggccccgaagtgccggctgccaccatgaatagtgaggagcagtactacgcggccacacagctctacaaggacccgtgcgcattccagaggggtccggtgccagagttcagtgctaatccccctgcgtgcctgtacatgggccgccagcccccacctccgccgccaccccagtttgcaggctcgctgggaacgctggaacagggaagtcccccggacatctccccatacgaagtgcccccgctcgccgatgacccggctggcgcgcacctccaccaccacctcccagctcagctcgggctcgcccatccacctcccggacctttcccgaatggaaccgagactgggggcctggaagagcccagccgcgttcatctccctttcccgtggatgaaatccaccaaagctcacgcgtggaaaagccagtgggcaggaggtgcatacgcagcagaaccggaggagaataagaggacccgtacagcctacactcgggcccagctgctggagctggagaaggaattcttatttaacaaatacatctcccggcctcgccgggtggagctggcagtgatgctcaacttgactgagagacacatcaaaatctggttccaaaaccgtcgcatgaagtggaagaaagaggaagataagaaacgtagtagcgggacaacgagcgggggcggtgggggcgaagagccggagcaggattgtgccgtaacctcgggcgaggagctgctggcattgccaccgccaccacctcccggaggtgctgtgccctcaggcgtccctgctgctgcccgggagggccgactgccttccggccttagtgcgtccccacagccctccagcatcgcgccactgcgaccgcaggaaccccggtgaggaccgcaggctgagggtgagcgggtctgggacccagagtgcggacatgggcatgggcccgggcagctggataagggaggggatcatgaggcttaacctaaacgccacacaaggagaacattcttcttgggggcacaagagccagttgggtatagccagcgagatgctggcagacctctgggaaaaaaaaagacccgagcttctgaaaactttgaggctgcctctcgtgccatgtgaaccgccaggtctgcctctgggactctttcctgggaccaatttagagaatcaggctcccaactgaggacaatgaaaaggttacaaacttgagcggtcccataacagccaccaggcgagctggaccgggtgcctttgactggtcggccgagcaatctaaggttgagaataaagggagctgtttgaggtttcaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]