LOCUS       NM_019381                898 bp    mRNA    linear   ROD 08-NOV-2023
DEFINITION  Rattus norvegicus transmembrane BAX inhibitor motif containing 6
            (Tmbim6), mRNA.
ACCESSION   NM_019381 XM_001063712 XM_576343
VERSION     NM_019381.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 898)
  AUTHORS   Chen W, DU H, Sha Y, Zhou Y, Liang J, Chen Y, Ma Q, Wu X and Qian
            G.
  TITLE     [Long noncoding RNA H19 promotes vascular calcification by
            repressing the Bax inhibitor 1/optic atrophy 1 pathway]
  JOURNAL   Nan Fang Yi Ke Da Xue Xue Bao 43 (9), 1469-1475 (2023)
   PUBMED   37814860
  REMARK    GeneRIF: [Long noncoding RNA H19 promotes vascular calcification by
            repressing the Bax inhibitor 1/optic atrophy 1 pathway].
REFERENCE   2  (bases 1 to 898)
  AUTHORS   Chen Y, Liu X, Li L, He X, Zheng F, Zhang Y, Gao H, Jin Z, Wu D,
            Wang Q, Tao H, Zhao Y, Liu W and Zou L.
  TITLE     Methyltransferase-like 3 aggravates endoplasmic reticulum stress in
            preeclampsia by targeting TMBIM6 in YTHDF2-dependent manner
  JOURNAL   Mol Med 29 (1), 19 (2023)
   PUBMED   36747144
  REMARK    GeneRIF: Methyltransferase-like 3 aggravates endoplasmic reticulum
            stress in preeclampsia by targeting TMBIM6 in YTHDF2-dependent
            manner.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 898)
  AUTHORS   Liu J, Zhou S, Zhang Y, Li X, Qian X, Tao W, Jin L and Zhao J.
  TITLE     Bax inhibitor-1 suppresses early brain injury following
            experimental subarachnoid hemorrhage in rats
  JOURNAL   Int J Mol Med 42 (5), 2891-2902 (2018)
   PUBMED   30226536
  REMARK    GeneRIF: The present study suggested that Bax inhibitor-1 serves a
            neuroprotective role in Early brain injury following subarachnoid
            hemorrhage by attenuating bloodbrain barrier disruption, brain
            edema and apoptosis mediated by endoplasmic reticulum stress.
REFERENCE   4  (bases 1 to 898)
  AUTHORS   Liu J, Zhou S, Qian X, Zhang Y and Zhao J.
  TITLE     [Over-expressed Bax inhibitor 1 (BI-1) inhibits apoptosis of
            hippocampal neurons via endoplasmic reticulum IRE1-JNK pathway in
            rats with subarachnoid hemorrhage]
  JOURNAL   Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi 33 (10), 1316-1322 (2017)
   PUBMED   29169414
  REMARK    GeneRIF: Bax inhibitor-1 (BI-1) over-expression improved
            neurobehavioral score, decreased hippocampal neuron apoptosis rate,
            and also down-regulated IRE1 protein levels in the rats with
            subarachnoid hemorrhage (SAH).
REFERENCE   5  (bases 1 to 898)
  AUTHORS   Urresti J, Ruiz-Meana M, Coccia E, Arevalo JC, Castellano J,
            Fernandez-Sanz C, Galenkamp KM, Planells-Ferrer L, Moubarak RS,
            Llecha-Cano N, Reix S, Garcia-Dorado D, Barneda-Zahonero B and
            Comella JX.
  TITLE     Lifeguard Inhibits Fas Ligand-mediated Endoplasmic
            Reticulum-Calcium Release Mandatory for Apoptosis in Type II
            Apoptotic Cells
  JOURNAL   J Biol Chem 291 (3), 1221-1234 (2016)
   PUBMED   26582200
REFERENCE   6  (bases 1 to 898)
  AUTHORS   Chae HJ, Kim HR, Xu C, Bailly-Maitre B, Krajewska M, Krajewski S,
            Banares S, Cui J, Digicaylioglu M, Ke N, Kitada S, Monosov E,
            Thomas M, Kress CL, Babendure JR, Tsien RY, Lipton SA and Reed JC.
  TITLE     BI-1 regulates an apoptosis pathway linked to endoplasmic reticulum
            stress
  JOURNAL   Mol Cell 15 (3), 355-366 (2004)
   PUBMED   15304216
REFERENCE   7  (bases 1 to 898)
  AUTHORS   Grzmil M, Thelen P, Hemmerlein B, Schweyer S, Voigt S, Mury D and
            Burfeind P.
  TITLE     Bax inhibitor-1 is overexpressed in prostate cancer and its
            specific down-regulation by RNA interference leads to cell death in
            human prostate carcinoma cells
  JOURNAL   Am J Pathol 163 (2), 543-552 (2003)
   PUBMED   12875974
REFERENCE   8  (bases 1 to 898)
  AUTHORS   Jean JC, Oakes SM and Joyce-Brady M.
  TITLE     The Bax inhibitor-1 gene is differentially regulated in adult
            testis and developing lung by two alternative TATA-less promoters
  JOURNAL   Genomics 57 (2), 201-208 (1999)
   PUBMED   10198159
REFERENCE   9  (bases 1 to 898)
  AUTHORS   Xu Q and Reed JC.
  TITLE     Bax inhibitor-1, a mammalian apoptosis suppressor identified by
            functional screening in yeast
  JOURNAL   Mol Cell 1 (3), 337-346 (1998)
   PUBMED   9660918
REFERENCE   10 (bases 1 to 898)
  AUTHORS   Walter L, Dirks B, Rothermel E, Heyens M, Szpirer C, Levan G and
            Gunther E.
  TITLE     A novel, conserved gene of the rat that is developmentally
            regulated in the testis
  JOURNAL   Mamm Genome 5 (4), 216-221 (1994)
   PUBMED   8012111
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC058478.1.
            
            On or before Jan 28, 2007 this sequence version replaced
            XM_576343.2, XM_001063712.1, NM_019381.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC058478.1, FQ218441.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132261, SAMD00132262
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-898               BC058478.1         7-904
FEATURES             Location/Qualifiers
     source          1..898
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="7"
                     /map="7q36"
     gene            1..898
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="transmembrane BAX inhibitor motif containing 6"
                     /db_xref="GeneID:24822"
                     /db_xref="RGD:3842"
     exon            1..53
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    47..49
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="upstream in-frame stop codon"
     exon            54..138
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     CDS             83..796
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="testis enhanced gene transcript; Bax inhibitor-1;
                     BI-1; testis-enhanced gene transcript protein;
                     transmembrane BAX inhibitor motif-containing protein 6"
                     /codon_start=1
                     /product="bax inhibitor 1"
                     /protein_id="NP_062254.2"
                     /db_xref="GeneID:24822"
                     /db_xref="RGD:3842"
                     /translation="

MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTRFIQAGLLSALGALALMICLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAINPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMFVSSLGNLFFGSIWLFQANLYMGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCIDLFLDFVTLFRKLMLILAFNEKDKKKEKK"

     misc_feature    128..766
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="BAX inhibitor (BI)-1; Region: BI-1; cd10430"
                     /db_xref="CDD:198412"
     misc_feature    170..232
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="propagated from UniProtKB/Swiss-Prot (P55062.2);
                     transmembrane region"
     misc_feature    239..301
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="propagated from UniProtKB/Swiss-Prot (P55062.2);
                     transmembrane region"
     misc_feature    341..403
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="propagated from UniProtKB/Swiss-Prot (P55062.2);
                     transmembrane region"
     misc_feature    419..481
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="propagated from UniProtKB/Swiss-Prot (P55062.2);
                     transmembrane region"
     misc_feature    500..562
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="propagated from UniProtKB/Swiss-Prot (P55062.2);
                     transmembrane region"
     misc_feature    581..643
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="propagated from UniProtKB/Swiss-Prot (P55062.2);
                     transmembrane region"
     exon            139..247
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     exon            248..368
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     exon            369..417
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     exon            418..515
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     exon            516..595
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     exon            596..696
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     exon            697..772
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     exon            773..898
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

agcacatccggttttagccgagcggggaagctccgaagaggtgggctaagaagcggaggctgcgctgaacagacttggagccatgaatatatttgatcggaagatcaactttgatgccctcttaaaattttcccacataactccctccacacagcagcacctaaagaaggtctatgccagttttgcactgtgcatgtttgtggcagcagcaggggcctatgtccatgtggtcacacgtttcatccaggctggcctgctctctgccctgggcgccctggccttgatgatttgcctgatggccacacctcacagccatgagacggagcagaagaggctgggactgctcgctggcttcgccttccttacaggagttggcctgggacctgccctggagctgtgcattgccatcaaccccagcatcctccccacggccttcatgggcacggccatgatcttcacctgcttcagcctgagtgccctctacgccaggcgccggagttacctctttttgggaggtatcttgatgtcagccatgagcctcatgttcgtgtcctctctggggaaccttttctttggatccatttggctgttccaggcaaacctgtacatggggctgctggtcatgtgcggctttgtcctcttcgacactcagctcattattgaaaaggctgaacacggagacaaggattacatctggcactgcattgacctcttcttggacttcgttacactcttcaggaagctcatgctgatcttggccttcaatgagaaggacaaaaagaaagagaagaagtgacgtggtgatcgatcggcctctcccagctcgccttctctccctcagccccgtttctttgcacacatcacaggtgtcgtgtcccatgacaatgaaaagcatcag

//