GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-02 12:20:35, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_012992               1307 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus nucleophosmin 1 (Npm1), mRNA.
ACCESSION   NM_012992
VERSION     NM_012992.4
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1307)
  AUTHORS   Pfister JA and D'Mello SR.
  TITLE     Regulation of Neuronal Survival by Nucleophosmin 1 (NPM1) Is
            Dependent on Its Expression Level, Subcellular Localization, and
            Oligomerization Status
  JOURNAL   J Biol Chem 291 (39), 20787-20797 (2016)
   PUBMED   27510036
  REMARK    GeneRIF: study suggests that although neurons need NPM1 for
            survival, an increase in its expression beyond physiological levels
            and its translocation to the cytoplasm leads to death through
            abortive cell cycle induction.
REFERENCE   2  (bases 1 to 1307)
  AUTHORS   Kim JY, Cho YE and Park JH.
  TITLE     The Nucleolar Protein GLTSCR2 Is an Upstream Negative Regulator of
            the Oncogenic Nucleophosmin-MYC Axis
  JOURNAL   Am J Pathol 185 (7), 2061-2068 (2015)
   PUBMED   25956029
REFERENCE   3  (bases 1 to 1307)
  AUTHORS   Kuzelova K, Brodska B, Fuchs O, Dobrovolna M, Soukup P and
            Cetkovsky P.
  TITLE     Altered HLA Class I Profile Associated with Type A/D Nucleophosmin
            Mutation Points to Possible Anti-Nucleophosmin Immune Response in
            Acute Myeloid Leukemia
  JOURNAL   PLoS One 10 (5), e0127637 (2015)
   PUBMED   25992555
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1307)
  AUTHORS   Milochau A, Lagree V, Benassy MN, Chaignepain S, Papin J,
            Garcia-Arcos I, Lajoix A, Monterrat C, Coudert L, Schmitter JM,
            Ochoa B and Lang J.
  TITLE     Synaptotagmin 11 interacts with components of the RNA-induced
            silencing complex RISC in clonal pancreatic beta-cells
  JOURNAL   FEBS Lett 588 (14), 2217-2222 (2014)
   PUBMED   24882364
REFERENCE   5  (bases 1 to 1307)
  AUTHORS   Mitrea DM, Grace CR, Buljan M, Yun MK, Pytel NJ, Satumba J, Nourse
            A, Park CG, Madan Babu M, White SW and Kriwacki RW.
  TITLE     Structural polymorphism in the N-terminal oligomerization domain of
            NPM1
  JOURNAL   Proc Natl Acad Sci U S A 111 (12), 4466-4471 (2014)
   PUBMED   24616519
REFERENCE   6  (bases 1 to 1307)
  AUTHORS   Takemura M, Ohta N, Furuichi Y, Takahashi T, Yoshida S, Olson MO
            and Umekawa H.
  TITLE     Stimulation of calf thymus DNA polymerase alpha activity by
            nucleolar protein B23
  JOURNAL   Biochem Biophys Res Commun 199 (1), 46-51 (1994)
   PUBMED   8123045
REFERENCE   7  (bases 1 to 1307)
  AUTHORS   Biggiogera M, Burki K, Kaufmann SH, Shaper JH, Gas N, Amalric F and
            Fakan S.
  TITLE     Nucleolar distribution of proteins B23 and nucleolin in mouse
            preimplantation embryos as visualized by immunoelectron microscopy
  JOURNAL   Development 110 (4), 1263-1270 (1990)
   PUBMED   2100262
REFERENCE   8  (bases 1 to 1307)
  AUTHORS   Chang JH and Olson MO.
  TITLE     Structure of the gene for rat nucleolar protein B23
  JOURNAL   J Biol Chem 265 (30), 18227-18233 (1990)
   PUBMED   2211699
REFERENCE   9  (bases 1 to 1307)
  AUTHORS   Chang JH and Olson MO.
  TITLE     A single gene codes for two forms of rat nucleolar protein B23 mRNA
  JOURNAL   J Biol Chem 264 (20), 11732-11737 (1989)
   PUBMED   2745414
REFERENCE   10 (bases 1 to 1307)
  AUTHORS   Chang JH, Dumbar TS and Olson MO.
  TITLE     cDNA and deduced primary structure of rat protein B23, a nucleolar
            protein containing highly conserved sequences
  JOURNAL   J Biol Chem 263 (26), 12824-12827 (1988)
   PUBMED   3417636
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC060579.1.
            
            On Aug 30, 2012 this sequence version replaced NM_012992.3.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC060579.1, J03969.1 [ECO:0000332]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1307              BC060579.1         5-1311
FEATURES             Location/Qualifiers
     source          1..1307
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="10"
                     /map="10q12"
     gene            1..1307
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="nucleophosmin 1"
                     /db_xref="GeneID:25498"
                     /db_xref="RGD:3192"
     exon            1..151
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /inference="alignment:Splign:2.1.0"
     CDS             94..972
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="nucleolar protein B23.1; NPM; numatrin; nucleolar
                     protein NO38; nucleolar phosphoprotein B23; nucleophosmin
                     (nucleolar phosphoprotein B23, numatrin)"
                     /codon_start=1
                     /product="nucleophosmin"
                     /protein_id="NP_037124.1"
                     /db_xref="GeneID:25498"
                     /db_xref="RGD:3192"
                     /translation="
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDDEDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL"
     misc_feature    94..648
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="propagated from UniProtKB/Swiss-Prot (P13084.1);
                     Region: Required for interaction with SENP3.
                     /evidence=ECO:0000250"
     misc_feature    94..444
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="propagated from UniProtKB/Swiss-Prot (P13084.1);
                     Region: Necessary for interaction with APEX1.
                     /evidence=ECO:0000250"
     misc_feature    94..96
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="N-acetylmethionine.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); acetylation site"
     misc_feature    103..105
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphoserine, by PLK1 and PLK2.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    121..123
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    145..444
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Nucleoplasmin/nucleophosmin domain; Region:
                     Nucleoplasmin; pfam03066"
                     /db_xref="CDD:427119"
     misc_feature    187..189
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="N6-acetyllysine, alternate.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); acetylation site"
     misc_feature    220..222
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    256..258
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Interaction between pentamers.
                     /evidence=ECO:0000250; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); other site"
     misc_feature    292..294
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphotyrosine.
                     /evidence=ECO:0000250|UniProtKB:Q61937; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    301..303
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    316..318
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphothreonine.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    331..333
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Interaction between pentamers.
                     /evidence=ECO:0000250; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); other site"
     misc_feature    376..378
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphothreonine.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    466..468
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphoserine, by CDK2.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    505..837
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="propagated from UniProtKB/Swiss-Prot (P13084.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    508..510
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    541..543
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="N6-acetyllysine, alternate.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); acetylation site"
     misc_feature    547..564
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="propagated from UniProtKB/Swiss-Prot (P13084.1);
                     Region: Nuclear localization signal.
                     /evidence=ECO:0000255"
     misc_feature    553..555
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); acetylation site"
     misc_feature    661..681
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="propagated from UniProtKB/Swiss-Prot (P13084.1);
                     Region: Nuclear localization signal.
                     /evidence=ECO:0000255"
     misc_feature    685..687
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphothreonine, by CDK1 and CDK2.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    724..726
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); acetylation site"
     misc_feature    742..744
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphothreonine, by CDK1. /evidence=ECO:0000250;
                     propagated from UniProtKB/Swiss-Prot (P13084.1);
                     phosphorylation site"
     misc_feature    766..768
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    772..774
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); acetylation site"
     misc_feature    775..777
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="N6-acetyllysine, alternate.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); acetylation site"
     misc_feature    787..789
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphothreonine, by CDK1.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    796..798
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphothreonine, by CDK1.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    811..813
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    814..969
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="propagated from UniProtKB/Swiss-Prot (P13084.1);
                     Region: Required for nucleolar localization.
                     /evidence=ECO:0000250"
     misc_feature    814..816
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    820..966
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Nucleophosmin C-terminal domain; Region: NPM1-C;
                     pfam16276"
                     /db_xref="CDD:435252"
     misc_feature    835..837
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="N6-acetyllysine, alternate.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); acetylation site"
     misc_feature    847..849
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    856..858
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="N6-acetyllysine, alternate.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); acetylation site"
     misc_feature    865..867
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    886..888
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="N6-acetyllysine, alternate.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); acetylation site"
     misc_feature    904..906
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="N6-acetyllysine, alternate.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); acetylation site"
     misc_feature    922..924
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="Phosphothreonine.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
     misc_feature    961..963
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P06748; propagated from
                     UniProtKB/Swiss-Prot (P13084.1); acetylation site"
     exon            152..231
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /inference="alignment:Splign:2.1.0"
     exon            232..351
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /inference="alignment:Splign:2.1.0"
     exon            352..445
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /inference="alignment:Splign:2.1.0"
     exon            446..552
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /inference="alignment:Splign:2.1.0"
     exon            553..614
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /inference="alignment:Splign:2.1.0"
     exon            615..672
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /inference="alignment:Splign:2.1.0"
     exon            673..756
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /inference="alignment:Splign:2.1.0"
     exon            757..858
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /inference="alignment:Splign:2.1.0"
     exon            859..933
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /inference="alignment:Splign:2.1.0"
     exon            934..1280
                     /gene="Npm1"
                     /gene_synonym="B23NP"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ggcgtgattccgtcctgcgtgtctgttctgcggaacagtaggcagttgttttccgtccggcttctctcacactcaagtgcgcgcctccacctcatggaagactcgatggacatggacatgagccctcttaggcctcagaactaccttttcggttgtgaactaaaggctgacaaagattatcactttaaagtggataatgatgaaaatgagcaccagttatcattaagaacggtcagtttaggagcaggggcaaaagatgagttgcacatcgtagaggcagaagcaatgaactatgaaggcagcccaattaaagtaacactggcaactttgaaaatgtctgtacaaccaacagtttcccttgggggcttcgaaattacaccacctgtggtcttgaggttgaagtgtggttctgggcctgtgcacataagtggacagcacctagtagctgtagaggaagatgcagagtcagaagatgaagatgaggaagatgtaaaactcttaggcatgtctggaaagagatctgctcccggaggtggtaacaaagtcccacagaaaaaagtaaaacttgatgaagatgatgatgaggatgatgaagatgatgaggatgatgaagatgatgatgatgatgattttgatgaagaggaaactgaagaaaaggttccagtgaagaaatctgtacgagataccccagccaaaaatgcacaaaaatcaaaccaaaatgggaaagatttaaaaccatcaacaccaaggtcaaagggtcaagagtccttcaaaaaacaggaaaaaactcccaaaacacccaaaggacctagctctgtagaagacattaaggcaaaaatgcaagcaagtatagaaaaaggtggttctcttcccaaagtggaagccaagttcattaattatgtgaagaattgtttccggatgactgaccaggaggctattcaagatctctggcagtggaggaagtctctttaagaaaatggtttaaacagtttgaaataattctgtcttcatttctgtaatagttgctatctggctgtcctttttataatgcaaagtgagaactttccctactgtgtttgataaatgttgtccaggttcaattgccaagaatgtgttgtctaaaatgcctgtttagttttcaaggatggaactccgccctttacttggttttaagtatgtatggaatgttatgataggacatagtagtagtggtggtcagatgtggaaatggtagggagacaaatatacatgtgaaataaactcagtattttaataaagtaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]