LOCUS       NM_012982               1976 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus msh homeobox 2 (Msx2), mRNA.
ACCESSION   NM_012982
VERSION     NM_012982.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1976)
  AUTHORS   Liu F, Liang Y and Lin X.
  TITLE     MiR-151b inhibits osteoblast differentiation via downregulating
            Msx2
  JOURNAL   Connect Tissue Res 63 (2), 112-123 (2022)
   PUBMED   33691558
  REMARK    GeneRIF: MiR-151b inhibits osteoblast differentiation via
            downregulating Msx2.
REFERENCE   2  (bases 1 to 1976)
  AUTHORS   Singh M, Del Carpio-Cano FE, Monroy MA, Popoff SN and Safadi FF.
  TITLE     Homeodomain transcription factors regulate BMP-2-induced
            osteoactivin transcription in osteoblasts
  JOURNAL   J Cell Physiol 227 (1), 390-399 (2012)
   PUBMED   21503878
  REMARK    GeneRIF: OA transcription is differentially regulated by Dlx3,
            Dlx5, and Msx2 during osteoblast differentiation.
REFERENCE   3  (bases 1 to 1976)
  AUTHORS   Le Bouffant R, Souquet B, Duval N, Duquenne C, Herve R, Frydman N,
            Robert B, Habert R and Livera G.
  TITLE     Msx1 and Msx2 promote meiosis initiation
  JOURNAL   Development 138 (24), 5393-5402 (2011)
   PUBMED   22071108
REFERENCE   4  (bases 1 to 1976)
  AUTHORS   Bensoussan-Trigano V, Lallemand Y, Saint Cloment C and Robert B.
  TITLE     Msx1 and Msx2 in limb mesenchyme modulate digit number and identity
  JOURNAL   Dev Dyn 240 (5), 1190-1202 (2011)
   PUBMED   21465616
REFERENCE   5  (bases 1 to 1976)
  AUTHORS   Suga T, Iso T, Shimizu T, Tanaka T, Yamagishi S, Takeuchi M,
            Imaizumi T and Kurabayashi M.
  TITLE     Activation of receptor for advanced glycation end products induces
            osteogenic differentiation of vascular smooth muscle cells
  JOURNAL   J Atheroscler Thromb 18 (8), 670-683 (2011)
   PUBMED   21512281
  REMARK    GeneRIF: activation of RAGE not only inhibits myocardin-dependent
            SMC gene expression, but also induces osteogenic differentiation of
            vascular SMC through Notch/Msx2 induction
REFERENCE   6  (bases 1 to 1976)
  AUTHORS   Ma L, Golden S, Wu L and Maxson R.
  TITLE     The molecular basis of Boston-type craniosynostosis: the
            Pro148-->His mutation in the N-terminal arm of the MSX2 homeodomain
            stabilizes DNA binding without altering nucleotide sequence
            preferences
  JOURNAL   Hum Mol Genet 5 (12), 1915-1920 (1996)
   PUBMED   8968743
REFERENCE   7  (bases 1 to 1976)
  AUTHORS   Phippard DJ, Weber-Hall SJ, Sharpe PT, Naylor MS, Jayatalake H,
            Maas R, Woo I, Roberts-Clark D, Francis-West PH, Liu YH, Maxson R,
            Hill RE and Dale TC.
  TITLE     Regulation of Msx-1, Msx-2, Bmp-2 and Bmp-4 during foetal and
            postnatal mammary gland development
  JOURNAL   Development 122 (9), 2729-2737 (1996)
   PUBMED   8787747
REFERENCE   8  (bases 1 to 1976)
  AUTHORS   Catron KM, Wang H, Hu G, Shen MM and Abate-Shen C.
  TITLE     Comparison of MSX-1 and MSX-2 suggests a molecular basis for
            functional redundancy
  JOURNAL   Mech Dev 55 (2), 185-199 (1996)
   PUBMED   8861098
  REMARK    Erratum:[Mech Dev 1996 May;56(1-2):223]
REFERENCE   9  (bases 1 to 1976)
  AUTHORS   Towler DA, Rutledge SJ and Rodan GA.
  TITLE     Msx-2/Hox 8.1: a transcriptional regulator of the rat osteocalcin
            promoter
  JOURNAL   Mol Endocrinol 8 (11), 1484-1493 (1994)
   PUBMED   7877617
REFERENCE   10 (bases 1 to 1976)
  AUTHORS   Begue-Kirn C, Smith AJ, Loriot M, Kupferle C, Ruch JV and Lesot H.
  TITLE     Comparative analysis of TGF beta s, BMPs, IGF1, msxs, fibronectin,
            osteonectin and bone sialoprotein gene expression during normal and
            in vitro-induced odontoblast differentiation
  JOURNAL   Int J Dev Biol 38 (3), 405-420 (1994)
   PUBMED   7848824
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000284.1.
            
            On Dec 8, 2006 this sequence version replaced NM_012982.2.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BF410343.1, BF396973.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5756307, SAMEA5760386
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-379               JACYVU010000284.1  11097214-11097592
            380-1976            JACYVU010000284.1  11101283-11102879
FEATURES             Location/Qualifiers
     source          1..1976
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="17"
                     /map="17p14"
     gene            1..1976
                     /gene="Msx2"
                     /note="msh homeobox 2"
                     /db_xref="GeneID:25483"
                     /db_xref="RGD:3116"
     CDS             1..804
                     /gene="Msx2"
                     /note="hox-8.1; homeobox protein Hox-8-1; msh homeo box
                     homolog 2"
                     /codon_start=1
                     /product="homeobox protein MSX-2"
                     /protein_id="NP_037114.2"
                     /db_xref="GeneID:25483"
                     /db_xref="RGD:3116"
                     /translation="

MASPSKGGDLFSSDEEGPAVLAGPGPGPGGAEGGAEERRVKVSSLPFSVEALMSDKKPPKESPAVPPDCASAGAVLRPLLLPGHGVRDAHSPGPLVKPFETASVKSENSEDGAPWIQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSGFSLPFPINSPLQAASIYSASYPFHRPVLPIPPVGLYATPVGYGMYHLS"

     misc_feature    order(427..441,445..447,496..498,514..516,553..555,
                     559..564,571..576,580..588,592..597)
                     /gene="Msx2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    433..594
                     /gene="Msx2"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(433..435,442..444,562..564,571..576,583..585)
                     /gene="Msx2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            1..379
                     /gene="Msx2"
                     /inference="alignment:Splign:2.1.0"
     exon            380..1976
                     /gene="Msx2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atggcttctccgtccaaaggcggtgacttgttttcgtctgatgaggagggccccgcggtgctggccggcccgggccccgggcctggaggagccgagggcggcgcggaggagcgcagggtcaaggtctccagcctgcccttcagcgtggaggcgctcatgtccgacaagaagccgcccaaggaatcgcccgcggtgccacccgactgcgcctcggctggcgctgtcctgcggccgctgttgctgccgggacacggcgtccgggacgctcacagtcccgggcctctcgtcaagcccttcgagaccgcctcggtcaagtcggaaaattccgaagacggagcgccgtggatacaggagcccggcagatactccccgccgcccagacacatgagccccaccacctgcaccctgaggaaacacaagaccaaccggaagccacgcacaccgttcaccacgtcccagcttctagccttggagcgcaagttccgccagaaacagtacctctccatcgcagagcgggccgagttctccagctctctgaaccttacagaaacccaggtcaaaatctggttccagaaccgaagggctaaggcaaaaagactgcaggaggcggaactggaaaagctgaaaatggctgccaaacctatgctgccctcgggcttcagtctgcccttccctatcaactcccccttgcaagcggcatccatatacagcgcctcctaccccttccatagacctgtgcttcccatcccgcctgtgggactctatgccacgccggtgggatatggcatgtaccatctatcctaaagaagaccagatggacacactctaggatggatgtttgtggaaagcattcccctccctctccaggaaggcggtgccaattttgctcctgaacgcaaaccctgcgttgtcgccctaagcaacaggcctgtgggggggccacttgatacagagtgaatttgttatttacgtgagaggcactaagaccgattttgttttcataatttcccaaatgtccccttttcctctcacagttattggctctgctagtttttatgtataaatatataataaaatataagactttttatatgccagatgtaaaaattcaagttattttggaaggcaaaatttatatatacgcttatccatttttctagatagcattttcttaagatattgtgtttagtccatttgctaccttttcttaaagggaaagagatttgtttgcagaactttcaaggaggatggacttgcttatggaggacatgccaggagtagacatagtgcatacaagatacagtttcagatatattcttgcaagggaagggggatgtgtaacatgttcttatgcattttaggtgcgtaagaaacaaaacctcttgagatgcacatttgatcttatttttctctcttctccattccatgttgtcaaatctgaggataactctgagaattactcagggtaaaagtgggattccatttcagggccctggcgtgcgagggtttagaagataaaacttgtgtaggaattggtttctgtgaaatgctaactacatcagtcctcacagggcacagaggagattgcaagagggcgtagttaaatatctgcttagaaatgagtgtcttgtaactgttgcctatatttgaaagattcttcaacagtccatagaatcaggaaggggaaaaaatgctttctctctgtgtgtgtgtacttactgtatgtgctaaatgtattagggactcgaacgtgtttggggtagacaatgaagccatgtgttgggcttggtggaaacaaacggtgttgtcagacaacacagtcagctagccccttggtctttcacctgcctgtccacctcttcccaatatatttttatcccgttgaaagggtatcttgtataattttatatattttattgaagagttatttcttatctcatactctgaattaaattaaaatgttttattgcagtaaa

//