2024-04-25 21:25:45, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_012943 1390 bp mRNA linear ROD 22-MAR-2023 DEFINITION Rattus norvegicus distal-less homeobox 5 (Dlx5), mRNA. ACCESSION NM_012943 VERSION NM_012943.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1390) AUTHORS Li X, Wu Y, Xie F, Zhang F, Zhang S, Zhou J, Chen D and Liu A. TITLE miR-339-5p negatively regulates loureirin A-induced hair follicle stem cell differentiation by targeting DLX5 JOURNAL Mol Med Rep 18 (2), 1279-1286 (2018) PUBMED 29901112 REMARK GeneRIF: these results suggest that miR3395p negatively regulated loureirin Ainduced HFSC differentiation by targeting DLX5, resulting in Wnt/betacatenin signaling pathway inhibition. REFERENCE 2 (bases 1 to 1390) AUTHORS Garaffo G, Conte D, Provero P, Tomaiuolo D, Luo Z, Pinciroli P, Peano C, D'Atri I, Gitton Y, Etzion T, Gothilf Y, Gays D, Santoro MM and Merlo GR. TITLE The Dlx5 and Foxg1 transcription factors, linked via miRNA-9 and -200, are required for the development of the olfactory and GnRH system JOURNAL Mol Cell Neurosci 68, 103-119 (2015) PUBMED 25937343 REFERENCE 3 (bases 1 to 1390) AUTHORS Takai H, Mezawa M, Choe J, Nakayama Y and Ogata Y. TITLE Osteogenic transcription factors and proto-oncogene regulate bone sialoprotein gene transcription JOURNAL J Oral Sci 55 (3), 209-215 (2013) PUBMED 24042587 REMARK GeneRIF: results demonstrate that overexpression of Runx2, Dlx5 or c-Src stimulates BSP transcription, and suggest that Runx2, Dlx5 and c-Src might be crucial transcriptional regulators of mineralization and bone formation REFERENCE 4 (bases 1 to 1390) AUTHORS Singh M, Del Carpio-Cano FE, Monroy MA, Popoff SN and Safadi FF. TITLE Homeodomain transcription factors regulate BMP-2-induced osteoactivin transcription in osteoblasts JOURNAL J Cell Physiol 227 (1), 390-399 (2012) PUBMED 21503878 REMARK GeneRIF: OA transcription is differentially regulated by Dlx3, Dlx5, and Msx2 during osteoblast differentiation. REFERENCE 5 (bases 1 to 1390) AUTHORS Hie M, Iitsuka N, Otsuka T, Nakanishi A and Tsukamoto I. TITLE Zinc deficiency decreases osteoblasts and osteoclasts associated with the reduced expression of Runx2 and RANK JOURNAL Bone 49 (6), 1152-1159 (2011) PUBMED 21893222 REFERENCE 6 (bases 1 to 1390) AUTHORS Merlo GR, Paleari L, Mantero S, Genova F, Beverdam A, Palmisano GL, Barbieri O and Levi G. TITLE Mouse model of split hand/foot malformation type I JOURNAL Genesis 33 (2), 97-101 (2002) PUBMED 12112878 REFERENCE 7 (bases 1 to 1390) AUTHORS Eisenstat DD, Liu JK, Mione M, Zhong W, Yu G, Anderson SA, Ghattas I, Puelles L and Rubenstein JL. TITLE DLX-1, DLX-2, and DLX-5 expression define distinct stages of basal forebrain differentiation JOURNAL J Comp Neurol 414 (2), 217-237 (1999) PUBMED 10516593 REFERENCE 8 (bases 1 to 1390) AUTHORS Liu JK, Ghattas I, Liu S, Chen S and Rubenstein JL. TITLE Dlx genes encode DNA-binding proteins that are expressed in an overlapping and sequential pattern during basal ganglia differentiation JOURNAL Dev Dyn 210 (4), 498-512 (1997) PUBMED 9415433 REFERENCE 9 (bases 1 to 1390) AUTHORS Shirasawa T, Sakamoto K and Tkahashi H. TITLE Molecular cloning and evolutional analysis of a mammalian homologue of the Distal-less 3 (Dlx-3) homeobox gene JOURNAL FEBS Lett 351 (3), 380-384 (1994) PUBMED 7915995 REFERENCE 10 (bases 1 to 1390) AUTHORS Zhao GQ, Zhao S, Zhou X, Eberspaecher H, Solursh M and de Crombrugghe B. TITLE rDlx, a novel distal-less-like homeoprotein is expressed in developing cartilages and discrete neuronal tissues JOURNAL Dev Biol 164 (1), 37-51 (1994) PUBMED 7913069 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from L24443.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: L24443.1, D31734.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5760396 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1390 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="Sprague-Dawley" /db_xref="taxon:10116" /chromosome="4" /map="4q21" gene 1..1390 /gene="Dlx5" /gene_synonym="RDLX" /note="distal-less homeobox 5" /db_xref="GeneID:25431" /db_xref="RGD:2506" exon 1..533 /gene="Dlx5" /gene_synonym="RDLX" /inference="alignment:Splign:2.1.0" misc_feature 155..157 /gene="Dlx5" /gene_synonym="RDLX" /note="upstream in-frame stop codon" CDS 179..1048 /gene="Dlx5" /gene_synonym="RDLX" /note="DLX-3; homeobox protein DLX-3" /codon_start=1 /product="homeobox protein DLX-5" /protein_id="NP_037075.1" /db_xref="GeneID:25431" /db_xref="RGD:2506" /translation="
MTGVFDRRVPSIRSGDFQAPFPTSAAMHHPSQESPTLPESSATDSDYYSPAGAAPHGYCSPTSASYRKALNPYQYQYHSVNGSAAGYPAKAYADYGYASPYHQYGGAYNRVPSATSQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPTTSNQSPASSYLENSASWYPSAASSINSHLPPPGSLQHPLALASGTLY"
misc_feature 179..325 /gene="Dlx5" /gene_synonym="RDLX" /note="propagated from UniProtKB/Swiss-Prot (P50575.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 272..532 /gene="Dlx5" /gene_synonym="RDLX" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="CDD:432536" misc_feature 278..280 /gene="Dlx5" /gene_synonym="RDLX" /note="Phosphoserine, by MAPK14, in vitro. /evidence=ECO:0000250|UniProtKB:P70396; propagated from UniProtKB/Swiss-Prot (P50575.1); phosphorylation site" misc_feature order(590..604,608..610,659..661,677..679,716..718, 722..727,734..739,743..751,755..760) /gene="Dlx5" /gene_synonym="RDLX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 596..757 /gene="Dlx5" /gene_synonym="RDLX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(596..598,605..607,725..727,734..739,746..748) /gene="Dlx5" /gene_synonym="RDLX" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 770..937 /gene="Dlx5" /gene_synonym="RDLX" /note="propagated from UniProtKB/Swiss-Prot (P50575.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 827..829 /gene="Dlx5" /gene_synonym="RDLX" /note="Phosphoserine, by MAPK14, in vitro. /evidence=ECO:0000250|UniProtKB:P70396; propagated from UniProtKB/Swiss-Prot (P50575.1); phosphorylation site" misc_feature 986..1045 /gene="Dlx5" /gene_synonym="RDLX" /note="propagated from UniProtKB/Swiss-Prot (P50575.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 534..718 /gene="Dlx5" /gene_synonym="RDLX" /inference="alignment:Splign:2.1.0" exon 719..1390 /gene="Dlx5" /gene_synonym="RDLX" /inference="alignment:Splign:2.1.0" ORIGIN
gacagagcctccacgactcccagcctcctcctccccgccgccgccgccaccgccgccgcctcctcttcctcctcctcctccctcgctcccacagccatgtctgcttagaccagagcagctccacagccaattctggcagcagcggccgcctcaataggacagccaccgcccgggagctatgacaggagtgtttgacagaagagtcccaagcatccgatccggcgacttccaagctccgttcccgacgtccgccgccatgcaccacccgtctcaggaatcgccaactttgccggagtcctcggccaccgattctgactactacagtcccgcgggggccgcccctcatggctactgctctcctacctctgcttcttaccgcaaagcgctcaacccataccagtaccagtatcacagcgtgaacggctccgcagccggctacccggccaaggcttatgcggactacggctacgccagcccctaccaccagtacggaggcgcctacaaccgagtcccgagtgccaccagccagccagagaaagaagtggccgagccagaggtgaggatggtgaatggtaaaccaaagaaagttcgtaaacccaggactatttattccagctttcagctggccgctttacagagaaggtttcagaagactcagtacctcgccctgccagaacgcgcggagttggccgcctctctaggactgacgcaaacacaggtgaaaatctggtttcagaacaaaagatccaagatcaagaagatcatgaaaaacggggagatgcccccggagcacagtcccagctccagcgaccctatggcgtgtaactcgccacagtcaccagcggtgtgggagccccagggctcatcccgctctctcagccaccaccctcatgcccaccctacgacctccaaccagtcccccgcgtccagctacctggagaactcggcttcctggtacccaagtgcagccagctcaatcaattcccacctgccaccgcctggctccctgcagcacccgctggcactggcctccgggacgctttattagatgggctactctctcttgctcagttttgggactacagtgttttcctgttttagaaatcagaaagaaaggaattcatacggggatgtttgaacaatggaaacaaagattcatgtgtaaagctttttttttgcatgtaagttattgcatttcaaaggaccccgcccctttttttacgaaaagaacccttttttgcgcaactgtggacactatcaatggtgccttgaaatctatgacctcaacttttcaaaaagacttttttcaatgttattttaaccgtgtaaataagtgtagatagaggaattaaactgtatattctggataaataaaattatttcgaccatg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]