GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-02 15:08:57, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001399003            1115 bp    mRNA    linear   ROD 22-MAR-2023
DEFINITION  Rattus norvegicus mitochondrial ribosomal protein L15 (Mrpl15),
            transcript variant 1, mRNA; nuclear gene for mitochondrial product.
ACCESSION   NM_001399003 XM_006237805
VERSION     NM_001399003.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1115)
  AUTHORS   Brown A, Rathore S, Kimanius D, Aibara S, Bai XC, Rorbach J, Amunts
            A and Ramakrishnan V.
  TITLE     Structures of the human mitochondrial ribosome in native states of
            assembly
  JOURNAL   Nat Struct Mol Biol 24 (10), 866-869 (2017)
   PUBMED   28892042
REFERENCE   2  (bases 1 to 1115)
  AUTHORS   Brown A, Amunts A, Bai XC, Sugimoto Y, Edwards PC, Murshudov G,
            Scheres SHW and Ramakrishnan V.
  TITLE     Structure of the large ribosomal subunit from human mitochondria
  JOURNAL   Science 346 (6210), 718-722 (2014)
   PUBMED   25278503
REFERENCE   3  (bases 1 to 1115)
  AUTHORS   Baltz AG, Munschauer M, Schwanhausser B, Vasile A, Murakawa Y,
            Schueler M, Youngs N, Penfold-Brown D, Drew K, Milek M, Wyler E,
            Bonneau R, Selbach M, Dieterich C and Landthaler M.
  TITLE     The mRNA-bound proteome and its global occupancy profile on
            protein-coding transcripts
  JOURNAL   Mol Cell 46 (5), 674-690 (2012)
   PUBMED   22681889
REFERENCE   4  (bases 1 to 1115)
  AUTHORS   Castello A, Fischer B, Eichelbaum K, Horos R, Beckmann BM, Strein
            C, Davey NE, Humphreys DT, Preiss T, Steinmetz LM, Krijgsveld J and
            Hentze MW.
  TITLE     Insights into RNA biology from an atlas of mammalian mRNA-binding
            proteins
  JOURNAL   Cell 149 (6), 1393-1406 (2012)
   PUBMED   22658674
REFERENCE   5  (bases 1 to 1115)
  AUTHORS   Tarantino C, Paolella G, Cozzuto L, Minopoli G, Pastore L, Parisi S
            and Russo T.
  TITLE     miRNA 34a, 100, and 137 modulate differentiation of mouse embryonic
            stem cells
  JOURNAL   FASEB J 24 (9), 3255-3263 (2010)
   PUBMED   20439489
REFERENCE   6  (bases 1 to 1115)
  AUTHORS   Mootha VK, Bunkenborg J, Olsen JV, Hjerrild M, Wisniewski JR, Stahl
            E, Bolouri MS, Ray HN, Sihag S, Kamal M, Patterson N, Lander ES and
            Mann M.
  TITLE     Integrated analysis of protein composition, tissue diversity, and
            gene regulation in mouse mitochondria
  JOURNAL   Cell 115 (5), 629-640 (2003)
   PUBMED   14651853
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000160.1.
            
            On Dec 29, 2021 this sequence version replaced XM_006237805.4.
            
            ##Evidence-Data-START##
            Transcript exon combination :: FQ214529.1, FQ221067.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132261, SAMD00132262
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            gene product(s) localized to mito. :: inferred from homology
            RefSeq Select criteria             :: based on conservation,
                                                  expression, longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-173               JACYVU010000160.1  2738062-2738234
            174-328             JACYVU010000160.1  2739543-2739697
            329-494             JACYVU010000160.1  2740400-2740565
            495-618             JACYVU010000160.1  2745245-2745368
            619-1115            JACYVU010000160.1  2745984-2746480
FEATURES             Location/Qualifiers
     source          1..1115
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="5"
                     /map="5q12"
     gene            1..1115
                     /gene="Mrpl15"
                     /note="mitochondrial ribosomal protein L15"
                     /db_xref="GeneID:297799"
                     /db_xref="RGD:1304796"
     exon            1..173
                     /gene="Mrpl15"
                     /inference="alignment:Splign:2.1.0"
     CDS             69..956
                     /gene="Mrpl15"
                     /EC_number="3.6.5.3"
                     /note="isoform 1 is encoded by transcript variant 1; 39S
                     ribosomal protein L15, mitochondrial"
                     /codon_start=1
                     /product="39S ribosomal protein L15, mitochondrial isoform
                     1"
                     /protein_id="NP_001385932.1"
                     /db_xref="GeneID:297799"
                     /db_xref="RGD:1304796"
                     /translation="
MAGMAFGRGTSLDLLRSLPRVSLANLKPSLNSRKRERRPRDRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFNEGHSFRHQYQPLSLRRLQYLIDLGRVDPTQPIDLTQLVNGRGVTIQPLKRDYGVQLVEEGADTFQAKVNIEVQMASELAIAAIEKNGGVVTTAFYDPRSLEILCKPVPFFLRGQPIPKRMLPPEALVPYYTDAKNRGYLADPAKFPEARLELAMKYGYVLPDVTKDELFRMLSTRKDPRQIFFGLAPGWIVNMADKKILKPTDENLLKYYSS"
     misc_feature    222..590
                     /gene="Mrpl15"
                     /note="Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A;
                     Region: Ribosomal_L27A; pfam00828"
                     /db_xref="CDD:425890"
     exon            174..328
                     /gene="Mrpl15"
                     /inference="alignment:Splign:2.1.0"
     exon            329..494
                     /gene="Mrpl15"
                     /inference="alignment:Splign:2.1.0"
     exon            495..618
                     /gene="Mrpl15"
                     /inference="alignment:Splign:2.1.0"
     exon            619..1115
                     /gene="Mrpl15"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ggggcgtggccgtaaagcaatgcggagccttcgccgccttctgggcgcccttgaaaggaccgtgggccatggctggcatggcgtttggccgcgggaccagtctggaccttctgcggtccttgccgagagtgagcctggccaatctgaagcccagtcttaactccagaaaacgggaaagacgtccaagagatcggagaagaggtaggaagtgtggcagaggccataaaggagaaagacagagaggaacccggcccaggctgggctttgagggagggcagactccattttacatccgaatcccaaaatatggatttaatgaaggacatagtttcaggcaccagtatcagcctctgagtctcaggagactacagtatctcattgatttaggtcgagttgatccaactcaacctattgacttaacgcagcttgtgaatgggagaggtgtgaccatccagccacttaaaagggattatggggtccagctggttgaagagggtgctgatacttttcaagcaaaagttaatattgaggtgcagatggcttcagaattagccattgctgcaattgaaaaaaatggtggtgttgttactacagccttctatgacccaagaagtctagaaattctgtgcaagcctgttccattctttctgcgcggacaacccattccaaagagaatgcttccacccgaggcgctggtgccctattataccgatgcgaaaaaccgggggtacctggccgaccctgccaagtttcctgaagcaagactggaacttgccatgaagtatggctatgtccttcctgatgtcacgaaagacgaactcttcagaatgctcagcacccgcaaggatccaaggcagattttctttggtcttgctcctggctggatagtgaatatggcagataagaaaattctaaaacctacagatgagaatcttctcaagtattacagctcctgaactgccttcagtaaatcagacatgtgagccaggggggctgaacacgggctcgtgtgggccttaaagccgaggggctggtaccgcctgcactggtcaggtttcttgttctttttccatctgaaattaaataacaggcagcaaaagctgcatcggaactga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]