2024-04-25 17:34:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001105746 2231 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus POU class 6 homeobox 1 (Pou6f1), mRNA. ACCESSION NM_001105746 XM_001064836 XM_343334 VERSION NM_001105746.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 2231) AUTHORS Li WY, Li ZG, Fu XM, Wang XY, Lv ZX, Sun P, Zhu XF and Wang Y. TITLE Transgenic Schwann cells overexpressing POU6F1 promote sciatic nerve regeneration within acellular nerve allografts JOURNAL J Neural Eng 19 (6) (2022) PUBMED 36317259 REMARK GeneRIF: Transgenic Schwann cells overexpressing POU6F1 promote sciatic nerve regeneration within acellular nerve allografts. Publication Status: Online-Only REFERENCE 2 (bases 1 to 2231) AUTHORS Toda K, Yamamoto D, Fumoto M, Ikeshita N, Herningtyas EH, Iida K, Takahashi Y, Kaji H, Chihara K and Okimura Y. TITLE Involvement of mPOU (Brn-5), a class VI POU protein, in the gene expression of Pit-1 as well as PRL JOURNAL Mol Cell Endocrinol 280 (1-2), 20-29 (2008) PUBMED 17933456 REMARK GeneRIF: Brn-5 enhances prolactin gene expression directly in association with Pit-1 and CREB-binding protein, and indirectly via the activation of Pit-1 gene expression. REFERENCE 3 (bases 1 to 2231) AUTHORS Molinari S, Relaix F, Lemonnier M, Kirschbaum B, Schafer B and Buckingham M. TITLE A novel complex regulates cardiac actin gene expression through interaction of Emb, a class VI POU domain protein, MEF2D, and the histone transacetylase p300 JOURNAL Mol Cell Biol 24 (7), 2944-2957 (2004) PUBMED 15024082 REFERENCE 4 (bases 1 to 2231) AUTHORS Cui H and Bulleit RF. TITLE Expression of the POU transcription factor Brn-5 is an early event in the terminal differentiation of CNS neurons JOURNAL J Neurosci Res 52 (6), 625-632 (1998) PUBMED 9669311 REFERENCE 5 (bases 1 to 2231) AUTHORS Wey E and Schafer BW. TITLE Identification of novel DNA binding sites recognized by the transcription factor mPOU (POU6F1) JOURNAL Biochem Biophys Res Commun 220 (2), 274-279 (1996) PUBMED 8645295 REFERENCE 6 (bases 1 to 2231) AUTHORS Wey E, Lyons GE and Schafer BW. TITLE A human POU domain gene, mPOU, is expressed in developing brain and specific adult tissues JOURNAL Eur J Biochem 220 (3), 753-762 (1994) PUBMED 7908264 REFERENCE 7 (bases 1 to 2231) AUTHORS Andersen B, Schonemann MD, Pearse RV 2nd, Jenne K, Sugarman J and Rosenfeld MG. TITLE Brn-5 is a divergent POU domain factor highly expressed in layer IV of the neocortex JOURNAL J Biol Chem 268 (31), 23390-23398 (1993) PUBMED 7901208 REFERENCE 8 (bases 1 to 2231) AUTHORS Okamoto K, Wakamiya M, Noji S, Koyama E, Taniguchi S, Takemura R, Copeland NG, Gilbert DJ, Jenkins NA, Muramatsu M et al. TITLE A novel class of murine POU gene predominantly expressed in central nervous system JOURNAL J Biol Chem 268 (10), 7449-7457 (1993) PUBMED 8463278 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CH474035.2. On or before Oct 3, 2007 this sequence version replaced XM_343334.3, XM_001064836.1. ##Evidence-Data-START## Transcript exon combination :: L23204.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132265, SAMD00132285 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..2231 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..2231 /gene="Pou6f1" /gene_synonym="Brn5" /note="POU class 6 homeobox 1" /db_xref="GeneID:116545" /db_xref="RGD:620615" exon 1..845 /gene="Pou6f1" /gene_synonym="Brn5" /inference="alignment:Splign:2.1.0" misc_feature 690..692 /gene="Pou6f1" /gene_synonym="Brn5" /note="upstream in-frame stop codon" CDS 801..1706 /gene="Pou6f1" /gene_synonym="Brn5" /note="brain-5; brn-5 protein; brain-specific homeobox/POU domain protein 5" /codon_start=1 /product="POU domain, class 6, transcription factor 1" /protein_id="NP_001099216.1" /db_xref="GeneID:116545" /db_xref="RGD:620615" /translation="
MPGISSPILTNAQGQVIGALPWVVNSASVATPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPQPVAVRKPSTPESPAKSEVQPIQPTQAVPPPAVILTSPAPALKPSASAPIPITCSETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP"
misc_feature 831..968 /gene="Pou6f1" /gene_synonym="Brn5" /note="propagated from UniProtKB/Swiss-Prot (P56223.1); Region: 2 X 7 AA repeats of N-A-Q-G-Q-V-I" misc_feature <867..1265 /gene="Pou6f1" /gene_synonym="Brn5" /note="DNA polymerase III subunits gamma and tau; Provisional; Region: PRK14950" /db_xref="CDD:237864" misc_feature 996..1064 /gene="Pou6f1" /gene_synonym="Brn5" /note="propagated from UniProtKB/Swiss-Prot (P56223.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 1215..1439 /gene="Pou6f1" /gene_synonym="Brn5" /note="Pou domain - N-terminal to homeobox domain; Region: Pou; cl22952" /db_xref="CDD:451464" misc_feature order(1503..1517,1521..1523,1572..1574,1590..1592, 1629..1631,1635..1640,1647..1652,1656..1664,1668..1673) /gene="Pou6f1" /gene_synonym="Brn5" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1509..1670 /gene="Pou6f1" /gene_synonym="Brn5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(1509..1511,1518..1520,1638..1640,1647..1652, 1659..1661) /gene="Pou6f1" /gene_synonym="Brn5" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 846..1049 /gene="Pou6f1" /gene_synonym="Brn5" /inference="alignment:Splign:2.1.0" exon 1050..1191 /gene="Pou6f1" /gene_synonym="Brn5" /inference="alignment:Splign:2.1.0" exon 1192..1360 /gene="Pou6f1" /gene_synonym="Brn5" /inference="alignment:Splign:2.1.0" exon 1361..2231 /gene="Pou6f1" /gene_synonym="Brn5" /inference="alignment:Splign:2.1.0" ORIGIN
cggaaagatttctgcagcagtgctccccttccctgtgactgtgctccccttccctgtgactgtgctcccctcccctatgactatgctcttcctcccctgtgactgtgctccccttccccaagactgtgctccctttctttcaactgtatttcccctcctgtgactgtgctccccttcccagagactgtgctctcctgtgactgtgctcctcttctctgagactgtgctcccttcccccaagactatgttccccttcccagagactgtgttcccctcccctatcactgtgttcccctcccctgttactgtgctcccttcccctgtgactctgctctcctcccctgtgactgtgctccccttccccatgactgtgctccccttccccgtgactgtgctccccttccccatgactgtgctccccttccccgtgactgtgctcccctcccccgtcactatgctctcctcccccgtgactgtgctccccttccccgtgactgtgctccccttccccgtgactgtgctccccttccccgtgactgtgctccccttccccgtgactgtgctccccttccctgctatccccctgtacttgtctccctagtcttgagtaccagccagtggactagagcctgcagcccagtaccctcagccctcttccctctctgtgccctttcttgcctctcggtctctgagcaaggctcttcctccacccacagatcagtgccgcgtcccttgggggacagacgcaaatcctgggctccctcactacagctccagttattaccaacaccattcccagcatgcccgggatcagcagtccgatcctcaccaatgctcagggacaggttattggagcacttccatgggtagtgaactcagccagtgtggccacaccagcaccagcacagagcctgcaggtccaagctgtgactccccagctcttgttgaatgcccagggccaggtgatcgcaacactagccagcagccccctgcctcaacctgtggctgtccggaagccaagcacaccggagtcccctgcaaagagtgaggtgcaacccatccagccgacacaagccgtgcccccacctgctgtaatcctcaccagcccagctccagcactcaagccatcagcctcagctcccatcccaatcacctgctcagagacacctacagtcagtcagttggtatcaaaaccgcacactccgagtctggatgaggacgggatcaacttagaagagatccgggagtttgccaagaattttaagatccggaggctctccctgggtctgacacagacccaggtgggccaggctctgaccgcaacagaggggccagcctacagccaatcagccatctgcaggttcgagaagttagacatcacacccaagagtgcccagaagctgaagccggttttggaaaagtggttgaacgaggcagagctccggaaccaggaaggccagcagaatctgatggagtttgtgggcggcgagccctccaagaaacgcaagcggcgtacttccttcacaccacaggccatagaggctctcaatgcctactttgagaaaaaccccctgcccaccggccaggagatcaccgagatcgctaaggagctcaactatgaccgtgaggtggtgagggtctggttctgtaatcgacgccagacactcaagaacaccagcaagctgaatgtctttcagatcccctagggctcggggtcagcgtgttccttgtgcgaatccctcagcagtcagctgaagtcactgagtggcagtactgtgggcagctgtgcttgccctcggtcatgagactccacctgtgcatgtgtgtcaatgcctgcctcttctgcccacatatgtcacaccctggggaggcccgaggggctgcatgagagccctaggctctgggctgggcatgtggaaggagggggttggtggggtccttagaaaagcactttgccgaggtggtttctgaagggtgaattctggttgagaaccaggaaggctctgtctttggggcagggccgtagcaactcttggggacaactgtgtagtggctcttggttttggtgacgtcctttcccccttcccctcactcctctgtggctgtgccggtgtgacaacacaccgggtggaactgcagcctcacactgcctcccttcctctgaatatgggcacactgaaccccctgaaaggactgaggaatccagagagtcgtggtgtgctgctcagacc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]