2024-04-26 19:11:07, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001105745 2407 bp mRNA linear ROD 22-MAR-2023 DEFINITION Rattus norvegicus POU class 2 homeobox 3 (Pou2f3), mRNA. ACCESSION NM_001105745 XM_001059708 XM_343378 VERSION NM_001105745.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 2407) AUTHORS Glahder JA, Hansen CN, Vinther J, Madsen BS and Norrild B. TITLE A promoter within the E6 ORF of human papillomavirus type 16 contributes to the expression of the E7 oncoprotein from a monocistronic mRNA JOURNAL J Gen Virol 84 (Pt 12), 3429-3441 (2003) PUBMED 14645924 REFERENCE 2 (bases 1 to 2407) AUTHORS Cabral A, Fischer DF, Vermeij WP and Backendorf C. TITLE Distinct functional interactions of human Skn-1 isoforms with Ese-1 during keratinocyte terminal differentiation JOURNAL J Biol Chem 278 (20), 17792-17799 (2003) PUBMED 12624109 REFERENCE 3 (bases 1 to 2407) AUTHORS Andersen B, Weinberg WC, Rennekampff O, McEvilly RJ, Bermingham JR Jr, Hooshmand F, Vasilyev V, Hansbrough JF, Pittelkow MR, Yuspa SH and Rosenfeld MG. TITLE Functions of the POU domain genes Skn-1a/i and Tst-1/Oct-6/SCIP in epidermal differentiation JOURNAL Genes Dev 11 (14), 1873-1884 (1997) PUBMED 9242494 REFERENCE 4 (bases 1 to 2407) AUTHORS Yukawa K, Yasui T, Yamamoto A, Shiku H, Kishimoto T and Kikutani H. TITLE Epoc-1: a POU-domain gene expressed in murine epidermal basal cells and thymic stromal cells JOURNAL Gene 133 (2), 163-169 (1993) PUBMED 8224904 REFERENCE 5 (bases 1 to 2407) AUTHORS Andersen B, Schonemann MD, Flynn SE, Pearse RV 2nd, Singh H and Rosenfeld MG. TITLE Skn-1a and Skn-1i: two functionally distinct Oct-2-related factors expressed in epidermis JOURNAL Science 260 (5104), 78-82 (1993) PUBMED 7682011 REMARK Erratum:[Science. 1993 Dec 3;262(5139):1499. PMID: 8248794] COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH473975.1. On or before Oct 3, 2007 this sequence version replaced XM_343378.3, XM_001059708.1. ##Evidence-Data-START## Transcript exon combination :: L23862.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support SAMEA5756307, SAMEA5760383 [ECO:0000350] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..2407 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="8" /map="8q22" gene 1..2407 /gene="Pou2f3" /note="POU class 2 homeobox 3" /db_xref="GeneID:116544" /db_xref="RGD:621691" exon 1..103 /gene="Pou2f3" /inference="alignment:Splign:2.1.0" CDS 76..1368 /gene="Pou2f3" /note="Rov 1 pou-homeodomain protein; oct-11; transcription factor Skn-1; octamer-binding transcription factor 11; OTF-11; octamer-binding protein 11" /codon_start=1 /product="POU domain, class 2, transcription factor 3" /protein_id="NP_001099215.1" /db_xref="GeneID:116544" /db_xref="RGD:621691" /translation="
MVNLEPMHTEIKMSGDVADSTDARSTFGQVESGNDRNGLDFNRQIKTEDLGDTLQQSLSHRPCHLSQGPTMMPGNQMSGDMASLHPLQQLVLVPGHLQSVSQFLLSQTPPGQQGLQPNLLSFPQQQSTLLLPQTGPGLTSQAVGRPGLSGSSLEPHLEASQHLPGPKHLPGPGGNDEPTDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESSPSDPSASTPSSYPTLSEVFGRKRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPVKPPIYNSRLVSPSGSLGSLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAMNPSSAAFNSSGSWYRWNHPAYLH"
misc_feature 76..195 /gene="Pou2f3" /note="propagated from UniProtKB/Swiss-Prot (P42571.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 253..318 /gene="Pou2f3" /note="propagated from UniProtKB/Swiss-Prot (P42571.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 460..615 /gene="Pou2f3" /note="propagated from UniProtKB/Swiss-Prot (P42571.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 601..825 /gene="Pou2f3" /note="Found in Pit-Oct-Unc transcription factors; Region: POU; smart00352" /db_xref="CDD:197673" misc_feature 817..876 /gene="Pou2f3" /note="propagated from UniProtKB/Swiss-Prot (P42571.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(898..912,916..918,967..969,985..987,1024..1026, 1030..1035,1042..1047,1051..1059,1063..1068) /gene="Pou2f3" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 904..1065 /gene="Pou2f3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(904..906,913..915,1033..1035,1042..1047,1054..1056) /gene="Pou2f3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1138..1314 /gene="Pou2f3" /note="propagated from UniProtKB/Swiss-Prot (P42571.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 104..172 /gene="Pou2f3" /inference="alignment:Splign:2.1.0" exon 173..207 /gene="Pou2f3" /inference="alignment:Splign:2.1.0" exon 208..312 /gene="Pou2f3" /inference="alignment:Splign:2.1.0" exon 313..415 /gene="Pou2f3" /inference="alignment:Splign:2.1.0" exon 416..498 /gene="Pou2f3" /inference="alignment:Splign:2.1.0" exon 499..681 /gene="Pou2f3" /inference="alignment:Splign:2.1.0" exon 682..823 /gene="Pou2f3" /inference="alignment:Splign:2.1.0" exon 824..960 /gene="Pou2f3" /inference="alignment:Splign:2.1.0" exon 961..1122 /gene="Pou2f3" /inference="alignment:Splign:2.1.0" exon 1123..1189 /gene="Pou2f3" /inference="alignment:Splign:2.1.0" exon 1190..1328 /gene="Pou2f3" /inference="alignment:Splign:2.1.0" exon 1329..2407 /gene="Pou2f3" /inference="alignment:Splign:2.1.0" ORIGIN
gcttccccgggggccaggctggggcagcagcgagggacctgggggggcgctggctttggccccgcctggggcaggatggtgaatctggagcccatgcacacagagatcaagatgagtggggatgtcgctgattccacagatgcccgcagcacttttggtcaagtggagtcaggaaatgatcgaaatggcctagatttcaacagacagattaagacagaggatctgggtgacactttgcagcagagcctctcccacaggccatgccacctgagccaagggcctaccatgatgcctggaaaccaaatgtctggggacatggcttctctccatccacttcagcagcttgtgctggtccctggccacttacagtctgtatcccagtttctgctttcccagacccctcctgggcagcaaggtctgcagccgaatcttctctcctttccacagcaacagagcactctactcctcccacagacaggacctggcctcacctcccaggcagttggacgccctgggctgtcaggatcctctttagagccccacctggaagcttctcaacatctgccagggcccaagcatctgcctggccccggagggaatgacgaacccactgacctggaggagctggagaagttcgccaagaccttcaagcagaggcgcataaagctaggcttcacacagggggatgtgggattggcgatgggaaagctgtatggtaacgacttcagccagactaccatctcgagatttgaggccctcaacctgagtttcaagaacatgtgtaaactcaagccactgctggagaagtggctgaatgatgcagagtcctccccgtcagacccttcagcaagcactcccagctcgtaccccactctcagcgaagtatttggcaggaagaggaagaaacggaccagcatcgagaccaacatccgcctgactttggagaagcgatttcaagataaccctaaacccagctcggaagagatttccatgattgcggagcagttgtccatggagaaggaagtggtaagagtctggttctgcaatcgacgccaaaaggagaagagaatcaactgccctgtggccacacctgtcaagccgcccatctacaactcccggctggtctctccctcagggtctctgggctccctctcagtccctcctgtccacagcaccatgcctggaacagtaacgtcatcctgttcccctgggaacaacagcaggccctcgtctcccggctcaggactccatgccagcagccccacggcatctcaaaataactccaaagcagcaatgaacccctcctccgccgcctttaactcctcagggtcatggtaccgttggaaccatcccgcctacctccactgagaccaaaaacttcctcccgttccacctggcccctggttcccaccaggaggaagagcggccacaccttccacgtatggacagacactttgagactcggagcgggagaaatggccgctgctgaagagcaaacccacaatcttgccttctcctggatccagagcttccagagaaccaagctgtgaccaaaggccacactcttgccttgggctcttgatcaccccgctgggagtttaccgtgctcacccgtgacccgcttcatgctcacatgatggcttcacctattggagaaagggcattctgccattgttagttttcagctcaccggtgggattctgggacagccttttgctcgttgtgccaaactgcaagaagggtagattatggttttgactctgacctcagccacaatcctgaactgatccaaattctatgagaagactgaaatctcgtgtctctaccaaagccttattttgttaaattagcacagttttcttacagcatctccatttttgcccaactttcttttagcccttactcccttttctacaacaaaacctgtctatccttaggtcctacaaagtcccttcctctctacaaatggctaagctcccctctggccatgttgctccattcacgtgtactcttttgttgcccacatgttcccaagttcaagaacacttgttttttttctgttctctgtgggttttcttgtcctgtcccctctccttgctcctggccacagagaagtacacacactgtggccactttcttgtacatagtcctttcctactctgcactatgaccgttcatctttaatgtgtaatttcccagcgaaatgtttaactcaggtgtgcattttgaagatgtctctatattattttatcttctgttagaaaaggaagggggataccagagtgtggaacaccccacagagttcccacgtgagctggggttctgcagactttgtggaggaacatcgtatgtggagtctccttctgtgggtctgtgtgtaaaactgtcacatgaaagccatcccaga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]