GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-03-29 00:50:37, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001100781            2358 bp    mRNA    linear   ROD 23-MAR-2023
DEFINITION  Rattus norvegicus Nanog homeobox (Nanog), mRNA.
ACCESSION   NM_001100781 XM_001060618 XM_575662
VERSION     NM_001100781.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 2358)
  AUTHORS   Ding Z, Dai C, Shan W, Liu R, Lu W, Gao W, Zhang H, Huang W, Guan J
            and Yin Z.
  TITLE     TNF-alpha up-regulates Nanog by activating NF-kappaB pathway to
            induce primary rat spinal cord astrocytes dedifferentiation
  JOURNAL   Life Sci 287, 120126 (2021)
   PUBMED   34758295
  REMARK    GeneRIF: TNF-alpha up-regulates Nanog by activating NF-kappaB
            pathway to induce primary rat spinal cord astrocytes
            dedifferentiation.
REFERENCE   2  (bases 1 to 2358)
  AUTHORS   Chang CC, Li HH, Tsou SH, Hung HC, Liu GY, Korolenko TA, Lai TJ, Ho
            YJ and Lin CL.
  TITLE     The Pluripotency Factor Nanog Protects against Neuronal Amyloid
            beta-Induced Toxicity and Oxidative Stress through Insulin
            Sensitivity Restoration
  JOURNAL   Cells 9 (6), 1339 (2020)
   PUBMED   32471175
  REMARK    GeneRIF: The Pluripotency Factor Nanog Protects against Neuronal
            Amyloid beta-Induced Toxicity and Oxidative Stress through Insulin
            Sensitivity Restoration.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2358)
  AUTHORS   Festuccia N, Dubois A, Vandormael-Pournin S, Gallego Tejeda E,
            Mouren A, Bessonnard S, Mueller F, Proux C, Cohen-Tannoudji M and
            Navarro P.
  TITLE     Mitotic binding of Esrrb marks key regulatory regions of the
            pluripotency network
  JOURNAL   Nat Cell Biol 18 (11), 1139-1148 (2016)
   PUBMED   27723719
REFERENCE   4  (bases 1 to 2358)
  AUTHORS   Gu J, Ni Y, Xu L, Xu H and Cai Z.
  TITLE     Nanog interact with CDK6 to regulates astrocyte cells proliferation
            following spinal cord injury
  JOURNAL   Biochem Biophys Res Commun 469 (4), 1097-1103 (2016)
   PUBMED   26707878
  REMARK    GeneRIF: Taken together, these data suggested that both Nanog may
            play important roles in spinal cord pathophysiology via interact
            with CDK6.
REFERENCE   5  (bases 1 to 2358)
  AUTHORS   Hayashi Y, Caboni L, Das D, Yumoto F, Clayton T, Deller MC, Nguyen
            P, Farr CL, Chiu HJ, Miller MD, Elsliger MA, Deacon AM, Godzik A,
            Lesley SA, Tomoda K, Conklin BR, Wilson IA, Yamanaka S and
            Fletterick RJ.
  TITLE     Structure-based discovery of NANOG variant with enhanced properties
            to promote self-renewal and reprogramming of pluripotent stem cells
  JOURNAL   Proc Natl Acad Sci U S A 112 (15), 4666-4671 (2015)
   PUBMED   25825768
REFERENCE   6  (bases 1 to 2358)
  AUTHORS   Strumpf D, Mao CA, Yamanaka Y, Ralston A, Chawengsaksophak K, Beck
            F and Rossant J.
  TITLE     Cdx2 is required for correct cell fate specification and
            differentiation of trophectoderm in the mouse blastocyst
  JOURNAL   Development 132 (9), 2093-2102 (2005)
   PUBMED   15788452
REFERENCE   7  (bases 1 to 2358)
  AUTHORS   Hatano SY, Tada M, Kimura H, Yamaguchi S, Kono T, Nakano T, Suemori
            H, Nakatsuji N and Tada T.
  TITLE     Pluripotential competence of cells associated with Nanog activity
  JOURNAL   Mech Dev 122 (1), 67-79 (2005)
   PUBMED   15582778
REFERENCE   8  (bases 1 to 2358)
  AUTHORS   Hart AH, Hartley L, Ibrahim M and Robb L.
  TITLE     Identification, cloning and expression analysis of the pluripotency
            promoting Nanog genes in mouse and human
  JOURNAL   Dev Dyn 230 (1), 187-198 (2004)
   PUBMED   15108323
REFERENCE   9  (bases 1 to 2358)
  AUTHORS   Chambers I, Colby D, Robertson M, Nichols J, Lee S, Tweedie S and
            Smith A.
  TITLE     Functional expression cloning of Nanog, a pluripotency sustaining
            factor in embryonic stem cells
  JOURNAL   Cell 113 (5), 643-655 (2003)
   PUBMED   12787505
REFERENCE   10 (bases 1 to 2358)
  AUTHORS   Mitsui K, Tokuzawa Y, Itoh H, Segawa K, Murakami M, Takahashi K,
            Maruyama M, Maeda M and Yamanaka S.
  TITLE     The homeoprotein Nanog is required for maintenance of pluripotency
            in mouse epiblast and ES cells
  JOURNAL   Cell 113 (5), 631-642 (2003)
   PUBMED   12787504
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473964.2.
            
            On or before Sep 6, 2008 this sequence version replaced
            XM_575662.2, XM_001060618.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..2358
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="4"
                     /map="4q42"
     gene            1..2358
                     /gene="Nanog"
                     /note="Nanog homeobox"
                     /db_xref="GeneID:414065"
                     /db_xref="RGD:1303178"
     exon            1..357
                     /gene="Nanog"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    174..176
                     /gene="Nanog"
                     /note="upstream in-frame stop codon"
     CDS             204..1142
                     /gene="Nanog"
                     /codon_start=1
                     /product="homeobox protein NANOG"
                     /protein_id="NP_001094251.1"
                     /db_xref="GeneID:414065"
                     /db_xref="RGD:1303178"
                     /translation="
MSVDLSGPHSLPSCEEASNSGDSSPMPAVHLPEENYSCLQVSATEMLCTETASPPPSSGDLPLQDSPDSSSNPKLKLSGPEADEGPEKKEENKVLTKKQKMRTVFSQAQLCALKDRFQRQRYLSLQQMQDLSTILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGLTQKGSAPVEYPSIHCSYSQGYLMNASGNLPVWGSQTWTNPTWNNQTWTNPTWSNQTWTNPTWSNQAWSTQSWCTQAWNSQTWNAAPLHNFGEDSLQPYVPLQQNFSASDLEANLEATRESQAHFSTPQALELFLNYSVNSPGEI"
     misc_feature    495..665
                     /gene="Nanog"
                     /note="Homeodomain; Region: HOX; smart00389"
                     /db_xref="CDD:197696"
     misc_feature    order(501..512,516..518,567..569,585..587,624..626,
                     630..635,642..647,651..659,663..668)
                     /gene="Nanog"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(504..506,513..515,633..635,642..647,654..656)
                     /gene="Nanog"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    <753..>1076
                     /gene="Nanog"
                     /note="Sec24-related protein; Provisional; Region:
                     PTZ00395"
                     /db_xref="CDD:185594"
     exon            358..626
                     /gene="Nanog"
                     /inference="alignment:Splign:2.1.0"
     exon            627..713
                     /gene="Nanog"
                     /inference="alignment:Splign:2.1.0"
     exon            714..2358
                     /gene="Nanog"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
tcagataggctgatttcgagtctttctcttttgtgggaagaccgaggctcgcttctttttggcttgttgactcttttacatctggacatttaactcttacttttaagatctttccctctagacactgagttttaaagtcttaactttttggttgttaaaaacttttttttttttaaagtcccttcccttgccgttgggctgacatgagcgtggatctttctggtccccacagtctgcctagttgtgaggaagcatcgaactctggggattcctcgccgatgcctgccgttcatcttcctgaggaaaattattcttgcttacaagtgtctgctactgagatgctctgcacagagactgcctctcctccgccttcctctggggacctacctcttcaagatagccctgattcttctagcaatcccaagctaaagctgtctggtcccgaggctgacgagggccctgagaagaaagaagagaacaaggtcctcaccaagaagcagaagatgcggactgtgttctctcaggcccagttgtgtgcactcaaggataggtttcagaggcaaaggtacctcagcctccagcagatgcaagatctctctaccattctgaacctgagctataagcaggtgaagacctggttccaaaaccaaagaatgaagtgcaagaggtggcagaaaaaccaatggttgaagactagcaacggcctgactcagaagggctcagcgccggtggagtatcccagcatccattgcagctattctcagggctatctgatgaacgcgtctggaaaccttccagtatggggcagtcagacctggaccaacccaacttggaacaaccagacctggaccaacccaacctggagcaaccagacctggaccaacccaacttggagcaaccaggcctggagcactcagtcctggtgtactcaggcctggaacagccagacttggaacgctgctccgctccataacttcggggaggactccctgcagccttatgtgccgttgcagcaaaacttctccgccagtgatttggaggcgaatttggaagccactagggaaagccaggcgcattttagtaccccgcaagccttggaattgttcctgaactactccgtgaattctccaggcgaaatatgaggtttacacaacaactgggcttaaagtcagggcagggccagggtcagctttcttccttcttccaaagagttttatattgttcttattttttttttaattattattttgtttttgttttttgtttatcaaggtagggtttctctgtgtggttctggctgtcctggaattcactctgtagaccaggctggcctcgtactcagagatctgcctacttttgcctcctgaaggctagggctaaagattttctaaagattttcatagtttttatttttttaattattatctgttttcatgtttgtgtttttttgttttgtttttgtttttgtttttgtttatcaagatagggtttctctgtgtggctctagtagtcccggaaactggctctgtagaccaggctgtccttgaactcagaaatctgcctttgcctccggactgcggggactaaaggcagtatataaccacctggcacattgtttttatttttattcttttggtgccagaaagcaaacctaggactttgagctgggcacccactcaaccactgagctctgtttgcgacccccgtgttggctgcatttgtctgagctgggtaacttgtctttttttccgtgttaacgatgggcttcggagacagtgcactatacactctatcctcccccaggtctcacacacccaccctactccataccaacccaggcttgtctgtcttttttttttttggagctgaggactgaacccagggccttgcgctttctaggcaagcgctctacctctgagctaaatccccaacccttgtctgtctttttagaagcttgggtcttggtgtgcactgtgtatcgttttgaggggtgaggtttaaaagtatacaaattataaagattcatgcagatatggtggctcctctcaaggacgagacagaaggatcaccagtttgaggctatctcagatataaaataagttcaagaccagcctgtactatgtctaaatagtaagacagcatctcaacaaaataataaaactaaggtaaggagataaaagtaaagtctcaacaaaatacaagatctcgcctgttacagttctttgatttcctccgtgtctttgcagttccgccaagaggcttctatgttaatatctgtagaaagatgtttatatttgactgtaccatgataaaccagtgccagctggactagtttaaataaaacactaattttaccca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]