2024-04-26 17:33:34, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001100531 2757 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus distal-less homeobox 1 (Dlx1), mRNA. ACCESSION NM_001100531 XM_001059233 XM_230987 VERSION NM_001100531.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 2757) AUTHORS Bokenkamp R, van Brempt R, van Munsteren JC, van den Wijngaert I, de Hoogt R, Finos L, Goeman J, Groot AC, Poelmann RE, Blom NA and DeRuiter MC. TITLE Dlx1 and Rgs5 in the ductus arteriosus: vessel-specific genes identified by transcriptional profiling of laser-capture microdissected endothelial and smooth muscle cells JOURNAL PLoS One 9 (1), e86892 (2014) PUBMED 24489801 REMARK GeneRIF: Rgs5 and Dlx1 represent novel molecular targets for the regulation of ductus arteriosus maturation and closure. Publication Status: Online-Only REFERENCE 2 (bases 1 to 2757) AUTHORS Wang B, Long JE, Flandin P, Pla R, Waclaw RR, Campbell K and Rubenstein JL. TITLE Loss of Gsx1 and Gsx2 function rescues distinct phenotypes in Dlx1/2 mutants JOURNAL J Comp Neurol 521 (7), 1561-1584 (2013) PUBMED 23042297 REFERENCE 3 (bases 1 to 2757) AUTHORS Delogu A, Sellers K, Zagoraiou L, Bocianowska-Zbrog A, Mandal S, Guimera J, Rubenstein JL, Sugden D, Jessell T and Lumsden A. TITLE Subcortical visual shell nuclei targeted by ipRGCs develop from a Sox14+-GABAergic progenitor and require Sox14 to regulate daily activity rhythms JOURNAL Neuron 75 (4), 648-662 (2012) PUBMED 22920256 REFERENCE 4 (bases 1 to 2757) AUTHORS Feng L, Eisenstat DD, Chiba S, Ishizaki Y, Gan L and Shibasaki K. TITLE Brn-3b inhibits generation of amacrine cells by binding to and negatively regulating DLX1/2 in developing retina JOURNAL Neuroscience 195, 9-20 (2011) PUBMED 21875655 REFERENCE 5 (bases 1 to 2757) AUTHORS Petryniak MA, Potter GB, Rowitch DH and Rubenstein JL. TITLE Dlx1 and Dlx2 control neuronal versus oligodendroglial cell fate acquisition in the developing forebrain JOURNAL Neuron 55 (3), 417-433 (2007) PUBMED 17678855 REFERENCE 6 (bases 1 to 2757) AUTHORS Pleasure SJ, Anderson S, Hevner R, Bagri A, Marin O, Lowenstein DH and Rubenstein JL. TITLE Cell migration from the ganglionic eminences is required for the development of hippocampal GABAergic interneurons JOURNAL Neuron 28 (3), 727-740 (2000) PUBMED 11163262 REFERENCE 7 (bases 1 to 2757) AUTHORS Eisenstat DD, Liu JK, Mione M, Zhong W, Yu G, Anderson SA, Ghattas I, Puelles L and Rubenstein JL. TITLE DLX-1, DLX-2, and DLX-5 expression define distinct stages of basal forebrain differentiation JOURNAL J Comp Neurol 414 (2), 217-237 (1999) PUBMED 10516593 REFERENCE 8 (bases 1 to 2757) AUTHORS Liu JK, Ghattas I, Liu S, Chen S and Rubenstein JL. TITLE Dlx genes encode DNA-binding proteins that are expressed in an overlapping and sequential pattern during basal ganglia differentiation JOURNAL Dev Dyn 210 (4), 498-512 (1997) PUBMED 9415433 REFERENCE 9 (bases 1 to 2757) AUTHORS Qiu M, Bulfone A, Ghattas I, Meneses JJ, Christensen L, Sharpe PT, Presley R, Pedersen RA and Rubenstein JL. TITLE Role of the Dlx homeobox genes in proximodistal patterning of the branchial arches: mutations of Dlx-1, Dlx-2, and Dlx-1 and -2 alter morphogenesis of proximal skeletal and soft tissue structures derived from the first and second arches JOURNAL Dev Biol 185 (2), 165-184 (1997) PUBMED 9187081 REFERENCE 10 (bases 1 to 2757) AUTHORS Robel L, Ding M, James AJ, Lin X, Simeone A, Leckman JF and Vaccarino FM. TITLE Fibroblast growth factor 2 increases Otx2 expression in precursor cells from mammalian telencephalon JOURNAL J Neurosci 15 (12), 7879-7891 (1995) PUBMED 8613727 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH473949.1. On or before Oct 24, 2008 this sequence version replaced XM_001059233.1, XM_230987.4. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMEA5760393, SAMEA5760396 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..2757 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="3" /map="3q23" gene 1..2757 /gene="Dlx1" /note="distal-less homeobox 1" /db_xref="GeneID:296500" /db_xref="RGD:1309593" exon 1..862 /gene="Dlx1" /inference="alignment:Splign:2.1.0" misc_feature 457..459 /gene="Dlx1" /note="upstream in-frame stop codon" CDS 550..1317 /gene="Dlx1" /note="homeobox Dlx1" /codon_start=1 /product="homeobox protein DLX-1" /protein_id="NP_001094001.1" /db_xref="GeneID:296500" /db_xref="RGD:1309593" /translation="
MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGSSAGSYVPSYTSWYPSAHQEAMQQPQLM"
misc_feature order(934..948,952..954,1003..1005,1021..1023,1060..1062, 1066..1071,1078..1083,1087..1095,1099..1104) /gene="Dlx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 940..1101 /gene="Dlx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(940..942,949..951,1069..1071,1078..1083,1090..1092) /gene="Dlx1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 863..1062 /gene="Dlx1" /inference="alignment:Splign:2.1.0" exon 1063..2757 /gene="Dlx1" /inference="alignment:Splign:2.1.0" ORIGIN
caggcgttgggggcgggcgaagggtggggacagcaagggggagggcgacggcagggcgcggctggttggtttctggggcgggaagcgcgcgagggaggcgggaggctggagtcgcgcgccttcgaggtcccagcgcggacgccgcagcccattgtgcgtcccgttccgcgcgctctgttgcagaggagccccggccgggacgtgtggacccgactctccccaggcccggccgcgtcgcccgctctagtccagcagagccggagcttctcggaccaatccccggtgattatgcaagagagccgaccaatcagctccaccagctcatgaatatttatgaccttggctgagtcaaagctttgaaccgagtttggggagctcggcagcatcatgcttagacttttcaaagagacaaactccattttcttatgaatggaaagtgaaaacccctgttccgcttaaattgggttccttcctgtcctgagaaacatagagacccccaaaagggaagcagaggagaaaaagacccacacccagaccccgcgagaagagatgaccatgaccaccatgccagaaagtctcaacagcccggtgtcgggcaaggctgtgtttatggagtttgggccgcccaaccagcaaatgtctccttctcccatgtcccacgggcactactccatgcactgtttacactcggcgggccattcgcagcccgacggtgcctacagttcggcctcatccttctcccgaccgctgggctacccctacgtcaactcggtcagcagccacgcgtccagcccctacatcagttccgtgcagtcctaccccggcagcgccagcctcgcccagagccgcctggaggacccaggggcggactccgagaagagcaccgtggtggaaggcggagaagtgcgctttaacggcaaagggaaaaagatccgtaaacccaggacaatttattccagtttgcagttgcaggctttgaaccggaggttccaacaaactcagtacctagctctgcctgagagggcggagctggcggcctccttgggactcacacagactcaggtcaagatatggttccagaacaaacgctccaagttcaagaagctgatgaagcaaggcggggcagctctggagggcagcgcgctggcgaatggcagggccttgtctgccggctccccaccggtaccacccggctggaatccgaattcctcctctgggaagggctccggcagcagcgctggctcctacgtccccagctacacgtcgtggtatccctcagcgcaccaagaagctatgcagcagcctcaactgatgtgaggttatcagttcgcactcacccgcttcctgcccatctcccttggcccggcccctcccgcctccaggttcatccactcattcgcacgccctgggccggaaggagaagggcccaagggcgagggcgggggacgtaaaaataaaagaaaaaggaacagtgaaggcttgctgcctcctcggagcccctaaaaatctggcccagcgacttttcagctctgggcttgaacctggtttgggccacggtgacagcagagtgacctcaaagcgcaggcacaaccactggagacagccagtgcaacaagacaagccgctggacccgaccagactctcagctttgtgagactatcaggaaaaaaaaattacgtaggagggggaaatatgctcttttttcggttctgtccgtctttgtctcctttttgcaccgtctgtgcgccgaagtcaaggtcctcgtgtgtctgctgtcctctccaaaaagtcaccagatctgagccacactggtctgccggcagcccatcacgaaccctggaacgctttttttctgaatggtcttcttccgggccctgcttcaccatctgtgtagcttgtttgggcaatggggggaatcggagggaggggggttaatttattgaaaaacagacgctgagtgttggccaattccaagttctctgagacatggagtgggcactgtccaaacacactatttaccttaaacacaccagaagagggaacaaggatgggatggtggctttttaaggtacctggtaacttttgtactttgttggaatggagaagtggaggcagagtgatttgcattttacacgacccacatgattaaaaaataacaaaagaaatagtgaagtaaggaaagatatgtcaagccaacagaatgttgtcaaaaacgtttggacaagaacacccggccaagaagaaaaagcatactttgggcagcaagagagaggaccaagtgggttttggagagaaaataatttgtcctgtgaaagcaccccaattccaggtcgcttgaaagtcagacacaagcagctttaaatgatccccagtggctcgaccacagaacacaagtcatcaccctgaacgcacagcctctggtgcaggacctaatcgttgtacatattattattgttattgttgttattaattattattattgttctgtaaacacgttgcacaagcttagcctctttccgttccgtcgtgtgtggctgtaaaccccaatgctttgtgaaaatgagaatcttgacattttacttgtgaaatttggaaaatgtgaccgattgaaatcaaccgtgttttgtgttctctatgtcaaagtttagttttatattgagaatgttaacttattgctttgtatctcggggagtgggggaactttgtaaataagttataaagtttctttgagacagtaaaattatggtttcaagaaag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]