GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-26 17:33:34, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001100531            2757 bp    mRNA    linear   ROD 21-MAR-2023
DEFINITION  Rattus norvegicus distal-less homeobox 1 (Dlx1), mRNA.
ACCESSION   NM_001100531 XM_001059233 XM_230987
VERSION     NM_001100531.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 2757)
  AUTHORS   Bokenkamp R, van Brempt R, van Munsteren JC, van den Wijngaert I,
            de Hoogt R, Finos L, Goeman J, Groot AC, Poelmann RE, Blom NA and
            DeRuiter MC.
  TITLE     Dlx1 and Rgs5 in the ductus arteriosus: vessel-specific genes
            identified by transcriptional profiling of laser-capture
            microdissected endothelial and smooth muscle cells
  JOURNAL   PLoS One 9 (1), e86892 (2014)
   PUBMED   24489801
  REMARK    GeneRIF: Rgs5 and Dlx1 represent novel molecular targets for the
            regulation of ductus arteriosus maturation and closure.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2757)
  AUTHORS   Wang B, Long JE, Flandin P, Pla R, Waclaw RR, Campbell K and
            Rubenstein JL.
  TITLE     Loss of Gsx1 and Gsx2 function rescues distinct phenotypes in
            Dlx1/2 mutants
  JOURNAL   J Comp Neurol 521 (7), 1561-1584 (2013)
   PUBMED   23042297
REFERENCE   3  (bases 1 to 2757)
  AUTHORS   Delogu A, Sellers K, Zagoraiou L, Bocianowska-Zbrog A, Mandal S,
            Guimera J, Rubenstein JL, Sugden D, Jessell T and Lumsden A.
  TITLE     Subcortical visual shell nuclei targeted by ipRGCs develop from a
            Sox14+-GABAergic progenitor and require Sox14 to regulate daily
            activity rhythms
  JOURNAL   Neuron 75 (4), 648-662 (2012)
   PUBMED   22920256
REFERENCE   4  (bases 1 to 2757)
  AUTHORS   Feng L, Eisenstat DD, Chiba S, Ishizaki Y, Gan L and Shibasaki K.
  TITLE     Brn-3b inhibits generation of amacrine cells by binding to and
            negatively regulating DLX1/2 in developing retina
  JOURNAL   Neuroscience 195, 9-20 (2011)
   PUBMED   21875655
REFERENCE   5  (bases 1 to 2757)
  AUTHORS   Petryniak MA, Potter GB, Rowitch DH and Rubenstein JL.
  TITLE     Dlx1 and Dlx2 control neuronal versus oligodendroglial cell fate
            acquisition in the developing forebrain
  JOURNAL   Neuron 55 (3), 417-433 (2007)
   PUBMED   17678855
REFERENCE   6  (bases 1 to 2757)
  AUTHORS   Pleasure SJ, Anderson S, Hevner R, Bagri A, Marin O, Lowenstein DH
            and Rubenstein JL.
  TITLE     Cell migration from the ganglionic eminences is required for the
            development of hippocampal GABAergic interneurons
  JOURNAL   Neuron 28 (3), 727-740 (2000)
   PUBMED   11163262
REFERENCE   7  (bases 1 to 2757)
  AUTHORS   Eisenstat DD, Liu JK, Mione M, Zhong W, Yu G, Anderson SA, Ghattas
            I, Puelles L and Rubenstein JL.
  TITLE     DLX-1, DLX-2, and DLX-5 expression define distinct stages of basal
            forebrain differentiation
  JOURNAL   J Comp Neurol 414 (2), 217-237 (1999)
   PUBMED   10516593
REFERENCE   8  (bases 1 to 2757)
  AUTHORS   Liu JK, Ghattas I, Liu S, Chen S and Rubenstein JL.
  TITLE     Dlx genes encode DNA-binding proteins that are expressed in an
            overlapping and sequential pattern during basal ganglia
            differentiation
  JOURNAL   Dev Dyn 210 (4), 498-512 (1997)
   PUBMED   9415433
REFERENCE   9  (bases 1 to 2757)
  AUTHORS   Qiu M, Bulfone A, Ghattas I, Meneses JJ, Christensen L, Sharpe PT,
            Presley R, Pedersen RA and Rubenstein JL.
  TITLE     Role of the Dlx homeobox genes in proximodistal patterning of the
            branchial arches: mutations of Dlx-1, Dlx-2, and Dlx-1 and -2 alter
            morphogenesis of proximal skeletal and soft tissue structures
            derived from the first and second arches
  JOURNAL   Dev Biol 185 (2), 165-184 (1997)
   PUBMED   9187081
REFERENCE   10 (bases 1 to 2757)
  AUTHORS   Robel L, Ding M, James AJ, Lin X, Simeone A, Leckman JF and
            Vaccarino FM.
  TITLE     Fibroblast growth factor 2 increases Otx2 expression in precursor
            cells from mammalian telencephalon
  JOURNAL   J Neurosci 15 (12), 7879-7891 (1995)
   PUBMED   8613727
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473949.1.
            
            On or before Oct 24, 2008 this sequence version replaced
            XM_001059233.1, XM_230987.4.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA5760393,
                              SAMEA5760396 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..2757
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="3"
                     /map="3q23"
     gene            1..2757
                     /gene="Dlx1"
                     /note="distal-less homeobox 1"
                     /db_xref="GeneID:296500"
                     /db_xref="RGD:1309593"
     exon            1..862
                     /gene="Dlx1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    457..459
                     /gene="Dlx1"
                     /note="upstream in-frame stop codon"
     CDS             550..1317
                     /gene="Dlx1"
                     /note="homeobox Dlx1"
                     /codon_start=1
                     /product="homeobox protein DLX-1"
                     /protein_id="NP_001094001.1"
                     /db_xref="GeneID:296500"
                     /db_xref="RGD:1309593"
                     /translation="
MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGSSAGSYVPSYTSWYPSAHQEAMQQPQLM"
     misc_feature    order(934..948,952..954,1003..1005,1021..1023,1060..1062,
                     1066..1071,1078..1083,1087..1095,1099..1104)
                     /gene="Dlx1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    940..1101
                     /gene="Dlx1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(940..942,949..951,1069..1071,1078..1083,1090..1092)
                     /gene="Dlx1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            863..1062
                     /gene="Dlx1"
                     /inference="alignment:Splign:2.1.0"
     exon            1063..2757
                     /gene="Dlx1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
caggcgttgggggcgggcgaagggtggggacagcaagggggagggcgacggcagggcgcggctggttggtttctggggcgggaagcgcgcgagggaggcgggaggctggagtcgcgcgccttcgaggtcccagcgcggacgccgcagcccattgtgcgtcccgttccgcgcgctctgttgcagaggagccccggccgggacgtgtggacccgactctccccaggcccggccgcgtcgcccgctctagtccagcagagccggagcttctcggaccaatccccggtgattatgcaagagagccgaccaatcagctccaccagctcatgaatatttatgaccttggctgagtcaaagctttgaaccgagtttggggagctcggcagcatcatgcttagacttttcaaagagacaaactccattttcttatgaatggaaagtgaaaacccctgttccgcttaaattgggttccttcctgtcctgagaaacatagagacccccaaaagggaagcagaggagaaaaagacccacacccagaccccgcgagaagagatgaccatgaccaccatgccagaaagtctcaacagcccggtgtcgggcaaggctgtgtttatggagtttgggccgcccaaccagcaaatgtctccttctcccatgtcccacgggcactactccatgcactgtttacactcggcgggccattcgcagcccgacggtgcctacagttcggcctcatccttctcccgaccgctgggctacccctacgtcaactcggtcagcagccacgcgtccagcccctacatcagttccgtgcagtcctaccccggcagcgccagcctcgcccagagccgcctggaggacccaggggcggactccgagaagagcaccgtggtggaaggcggagaagtgcgctttaacggcaaagggaaaaagatccgtaaacccaggacaatttattccagtttgcagttgcaggctttgaaccggaggttccaacaaactcagtacctagctctgcctgagagggcggagctggcggcctccttgggactcacacagactcaggtcaagatatggttccagaacaaacgctccaagttcaagaagctgatgaagcaaggcggggcagctctggagggcagcgcgctggcgaatggcagggccttgtctgccggctccccaccggtaccacccggctggaatccgaattcctcctctgggaagggctccggcagcagcgctggctcctacgtccccagctacacgtcgtggtatccctcagcgcaccaagaagctatgcagcagcctcaactgatgtgaggttatcagttcgcactcacccgcttcctgcccatctcccttggcccggcccctcccgcctccaggttcatccactcattcgcacgccctgggccggaaggagaagggcccaagggcgagggcgggggacgtaaaaataaaagaaaaaggaacagtgaaggcttgctgcctcctcggagcccctaaaaatctggcccagcgacttttcagctctgggcttgaacctggtttgggccacggtgacagcagagtgacctcaaagcgcaggcacaaccactggagacagccagtgcaacaagacaagccgctggacccgaccagactctcagctttgtgagactatcaggaaaaaaaaattacgtaggagggggaaatatgctcttttttcggttctgtccgtctttgtctcctttttgcaccgtctgtgcgccgaagtcaaggtcctcgtgtgtctgctgtcctctccaaaaagtcaccagatctgagccacactggtctgccggcagcccatcacgaaccctggaacgctttttttctgaatggtcttcttccgggccctgcttcaccatctgtgtagcttgtttgggcaatggggggaatcggagggaggggggttaatttattgaaaaacagacgctgagtgttggccaattccaagttctctgagacatggagtgggcactgtccaaacacactatttaccttaaacacaccagaagagggaacaaggatgggatggtggctttttaaggtacctggtaacttttgtactttgttggaatggagaagtggaggcagagtgatttgcattttacacgacccacatgattaaaaaataacaaaagaaatagtgaagtaaggaaagatatgtcaagccaacagaatgttgtcaaaaacgtttggacaagaacacccggccaagaagaaaaagcatactttgggcagcaagagagaggaccaagtgggttttggagagaaaataatttgtcctgtgaaagcaccccaattccaggtcgcttgaaagtcagacacaagcagctttaaatgatccccagtggctcgaccacagaacacaagtcatcaccctgaacgcacagcctctggtgcaggacctaatcgttgtacatattattattgttattgttgttattaattattattattgttctgtaaacacgttgcacaagcttagcctctttccgttccgtcgtgtgtggctgtaaaccccaatgctttgtgaaaatgagaatcttgacattttacttgtgaaatttggaaaatgtgaccgattgaaatcaaccgtgttttgtgttctctatgtcaaagtttagttttatattgagaatgttaacttattgctttgtatctcggggagtgggggaactttgtaaataagttataaagtttctttgagacagtaaaattatggtttcaagaaag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]