2024-04-26 07:32:38, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001082541 1514 bp mRNA linear ROD 21-DEC-2022 DEFINITION Rattus norvegicus heterogeneous nuclear ribonucleoprotein D (Hnrnpd), transcript variant 4, mRNA. ACCESSION NM_001082541 VERSION NM_001082541.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1514) AUTHORS Yan J, Du F, Li SD, Yuan Y, Jiang JY, Li S, Li XY and Du ZX. TITLE AUF1 modulates TGF-beta signal in renal tubular epithelial cells via post-transcriptional regulation of Nedd4L expression JOURNAL Biochim Biophys Acta Mol Cell Res 1865 (1), 48-56 (2018) PUBMED 28986222 REMARK GeneRIF: AUF1 might be a potential player in renal tubulointerstitial fibrosis through modulation of TGF-beta signal transduction via posttranscriptional regulation of Nedd4L. REFERENCE 2 (bases 1 to 1514) AUTHORS Castellanos-Rubio A, Fernandez-Jimenez N, Kratchmarov R, Luo X, Bhagat G, Green PH, Schneider R, Kiledjian M, Bilbao JR and Ghosh S. TITLE A long noncoding RNA associated with susceptibility to celiac disease JOURNAL Science 352 (6281), 91-95 (2016) PUBMED 27034373 REFERENCE 3 (bases 1 to 1514) AUTHORS Lee KH, Kim SH, Kim HJ, Kim W, Lee HR, Jung Y, Choi JH, Hong KY, Jang SK and Kim KT. TITLE AUF1 contributes to Cryptochrome1 mRNA degradation and rhythmic translation JOURNAL Nucleic Acids Res 42 (6), 3590-3606 (2014) PUBMED 24423872 REFERENCE 4 (bases 1 to 1514) AUTHORS Baltz AG, Munschauer M, Schwanhausser B, Vasile A, Murakawa Y, Schueler M, Youngs N, Penfold-Brown D, Drew K, Milek M, Wyler E, Bonneau R, Selbach M, Dieterich C and Landthaler M. TITLE The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts JOURNAL Mol Cell 46 (5), 674-690 (2012) PUBMED 22681889 REFERENCE 5 (bases 1 to 1514) AUTHORS Castello A, Fischer B, Eichelbaum K, Horos R, Beckmann BM, Strein C, Davey NE, Humphreys DT, Preiss T, Steinmetz LM, Krijgsveld J and Hentze MW. TITLE Insights into RNA biology from an atlas of mammalian mRNA-binding proteins JOURNAL Cell 149 (6), 1393-1406 (2012) PUBMED 22658674 REFERENCE 6 (bases 1 to 1514) AUTHORS Raineri I, Wegmueller D, Gross B, Certa U and Moroni C. TITLE Roles of AUF1 isoforms, HuR and BRF1 in ARE-dependent mRNA turnover studied by RNA interference JOURNAL Nucleic Acids Res 32 (4), 1279-1288 (2004) PUBMED 14976220 REMARK Publication Status: Online-Only REFERENCE 7 (bases 1 to 1514) AUTHORS Arao Y, Kikuchi A, Ikeda K, Nomoto S, Horiguchi H and Kayama F. TITLE A+U-rich-element RNA-binding factor 1/heterogeneous nuclear ribonucleoprotein D gene expression is regulated by oestrogen in the rat uterus JOURNAL Biochem J 361 (Pt 1), 125-132 (2002) PUBMED 11742537 REFERENCE 8 (bases 1 to 1514) AUTHORS Faura M, Renau-Piqueras J, Bachs O and Bosser R. TITLE Differential distribution of heterogeneous nuclear ribonucleoproteins in rat tissues JOURNAL Biochem Biophys Res Commun 217 (2), 554-560 (1995) PUBMED 7503735 REFERENCE 9 (bases 1 to 1514) AUTHORS Ehrenman K, Long L, Wagner BJ and Brewer G. TITLE Characterization of cDNAs encoding the murine A+U-rich RNA-binding protein AUF1 JOURNAL Gene 149 (2), 315-319 (1994) PUBMED 7959009 REFERENCE 10 (bases 1 to 1514) AUTHORS Ishikawa F, Matunis MJ, Dreyfuss G and Cech TR. TITLE Nuclear proteins that bind the pre-mRNA 3' splice site sequence r(UUAG/G) and the human telomeric DNA sequence d(TTAGGG)n JOURNAL Mol Cell Biol 13 (7), 4301-4310 (1993) PUBMED 8321232 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CO560068.1, AB046618.1 and CB798484.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## CDS exon combination :: AB046618.1 [ECO:0000331] RNAseq introns :: single sample supports all introns SAMD00132261, SAMD00132262 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-636 CO560068.1 1-636 637-1143 AB046618.1 352-858 1144-1514 CB798484.1 23-393 FEATURES Location/Qualifiers source 1..1514 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="14" /map="14p22" gene 1..1514 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /note="heterogeneous nuclear ribonucleoprotein D" /db_xref="GeneID:79256" /db_xref="RGD:620365" exon 1..512 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /inference="alignment:Splign:2.1.0" misc_feature 187..189 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /note="upstream in-frame stop codon" CDS 286..1143 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /note="isoform d is encoded by transcript variant 4; heterogeneous nuclear ribonucleoprotein D0; hnRNP D0; AU-rich element RNA-binding protein 1; AU-rich element RNA-binding factor 1; RNA binding protein p45AUF1" /codon_start=1 /product="heterogeneous nuclear ribonucleoprotein D0 isoform d" /protein_id="NP_001076010.1" /db_xref="GeneID:79256" /db_xref="RGD:620365" /translation="
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAQGAAAAAGSGSGGGSAPGGTEGGSTEAEGAKIDASKNEEDEGKMFIGGLSWDTTKKDLKDYFSKFGDVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVSRRGGHQNSYKPY"
misc_feature <448..513 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /note="CBFNT (NUC161) domain; Region: CBFNT; pfam08143" /db_xref="CDD:311868" misc_feature 517..738 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /note="RNA recognition motif 1 (RRM1) found in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins; Region: RRM1_hnRNPD; cd12756" /db_xref="CDD:410150" misc_feature 769..993 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /note="RNA recognition motif 2 (RRM2) found in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins; Region: RRM2_hnRNPD; cd12583" /db_xref="CDD:241027" misc_feature order(769..771,775..777,781..786,856..867,871..876, 883..891,895..897,901..903,952..954,973..981,985..993) /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:241027" exon 513..681 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /inference="alignment:Splign:2.1.0" exon 682..843 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /inference="alignment:Splign:2.1.0" exon 844..975 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /inference="alignment:Splign:2.1.0" exon 976..1075 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /inference="alignment:Splign:2.1.0" exon 1076..1173 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /inference="alignment:Splign:2.1.0" exon 1174..1501 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /inference="alignment:Splign:2.1.0" ORIGIN
gcggcggcgccattaaagcgaggaggaggcgagagtggccgccgctgctacttattcttttttagtgcagccggggagagtgagagtgcgcgctgcgcgagagtgggaggcgaggggggcaggccggggagaggcgcaggagcctttgcagccacgcgcgcgccttgtcttgtgtgcctcgcgaggtagagcgggcgcgcggcggcggcggggattactttgctgctagtttcggttcgcggcggcggcgggtgtcgtctcggcggcggcggaggcagtagcactatgtcggaggagcagttcggaggggacggggcggcggcggcggcaacggcggcggtaggcggctcggcgggcgagcaggagggagccatggtggcggcggcgcagggggcagcggcggcggcgggaagcgggagcggcggcggctctgcgcccggaggcaccgaaggaggcagcaccgaggcagagggagcgaagatcgacgccagtaagaatgaggaggatgaagggaaaatgtttataggaggccttagctgggacaccacaaagaaagacctgaaggactacttttccaaatttggggacgttgtagactgcactctgaagttagatcctatcacagggcgatcaaggggttttggctttgtgctatttaaagagtcggagagtgtagataaggtcatggatcagaaagaacataaattgaatgggaaagtcattgatcctaaaagggccaaagccatgaaaacaaaagagcccgtcaaaaaaatttttgttggtggcctttctccagacacacctgaagaaaaaataagagagtactttggtggttttggtgaggttgaatccatagagctgcctatggacaacaagaccaataagaggcgtgggttctgtttcattacctttaaggaagaggaaccagtgaagaagataatggagaagaaataccacaatgttggtcttagtaaatgtgaaataaaagtagccatgtcgaaggagcagtatcagcagcagcagcagtggggatctagaggagggtttgcaggaagagctcgcggaagaggcggtgatcagcagagtggttatgggaaagtatccagacgaggtggtcatcaaaatagctacaaaccatactaaattattccatttgcaacttatccccaacaggtggtgaagcagtattttccaatttgaagattcatttgaaggtggctcctgccacctgctaatagcagttcaaactaaattttttctatcaagttcccgaatggaagtatgacgttgggtccctctgaagtttaattctgagttctcattaaaagaatttgctttcattgttttatttcttaattgctatgcttcagtatcaatttgtgttttatgcccccctcccccccagtattgtagagcaagtcttgtgttacaagcccagtgtgacagtgtcatgatgtagtagtgtcttactggttttttaataaatccttttgtataaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]