GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-03-29 09:50:15, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001082540            1571 bp    mRNA    linear   ROD 19-DEC-2022
DEFINITION  Rattus norvegicus heterogeneous nuclear ribonucleoprotein D
            (Hnrnpd), transcript variant 3, mRNA.
ACCESSION   NM_001082540
VERSION     NM_001082540.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1571)
  AUTHORS   Yan J, Du F, Li SD, Yuan Y, Jiang JY, Li S, Li XY and Du ZX.
  TITLE     AUF1 modulates TGF-beta signal in renal tubular epithelial cells
            via post-transcriptional regulation of Nedd4L expression
  JOURNAL   Biochim Biophys Acta Mol Cell Res 1865 (1), 48-56 (2018)
   PUBMED   28986222
  REMARK    GeneRIF: AUF1 might be a potential player in renal
            tubulointerstitial fibrosis through modulation of TGF-beta signal
            transduction via posttranscriptional regulation of Nedd4L.
REFERENCE   2  (bases 1 to 1571)
  AUTHORS   Castellanos-Rubio A, Fernandez-Jimenez N, Kratchmarov R, Luo X,
            Bhagat G, Green PH, Schneider R, Kiledjian M, Bilbao JR and Ghosh
            S.
  TITLE     A long noncoding RNA associated with susceptibility to celiac
            disease
  JOURNAL   Science 352 (6281), 91-95 (2016)
   PUBMED   27034373
REFERENCE   3  (bases 1 to 1571)
  AUTHORS   Lee KH, Kim SH, Kim HJ, Kim W, Lee HR, Jung Y, Choi JH, Hong KY,
            Jang SK and Kim KT.
  TITLE     AUF1 contributes to Cryptochrome1 mRNA degradation and rhythmic
            translation
  JOURNAL   Nucleic Acids Res 42 (6), 3590-3606 (2014)
   PUBMED   24423872
REFERENCE   4  (bases 1 to 1571)
  AUTHORS   Baltz AG, Munschauer M, Schwanhausser B, Vasile A, Murakawa Y,
            Schueler M, Youngs N, Penfold-Brown D, Drew K, Milek M, Wyler E,
            Bonneau R, Selbach M, Dieterich C and Landthaler M.
  TITLE     The mRNA-bound proteome and its global occupancy profile on
            protein-coding transcripts
  JOURNAL   Mol Cell 46 (5), 674-690 (2012)
   PUBMED   22681889
REFERENCE   5  (bases 1 to 1571)
  AUTHORS   Castello A, Fischer B, Eichelbaum K, Horos R, Beckmann BM, Strein
            C, Davey NE, Humphreys DT, Preiss T, Steinmetz LM, Krijgsveld J and
            Hentze MW.
  TITLE     Insights into RNA biology from an atlas of mammalian mRNA-binding
            proteins
  JOURNAL   Cell 149 (6), 1393-1406 (2012)
   PUBMED   22658674
REFERENCE   6  (bases 1 to 1571)
  AUTHORS   Raineri I, Wegmueller D, Gross B, Certa U and Moroni C.
  TITLE     Roles of AUF1 isoforms, HuR and BRF1 in ARE-dependent mRNA turnover
            studied by RNA interference
  JOURNAL   Nucleic Acids Res 32 (4), 1279-1288 (2004)
   PUBMED   14976220
  REMARK    Publication Status: Online-Only
REFERENCE   7  (bases 1 to 1571)
  AUTHORS   Arao Y, Kikuchi A, Ikeda K, Nomoto S, Horiguchi H and Kayama F.
  TITLE     A+U-rich-element RNA-binding factor 1/heterogeneous nuclear
            ribonucleoprotein D gene expression is regulated by oestrogen in
            the rat uterus
  JOURNAL   Biochem J 361 (Pt 1), 125-132 (2002)
   PUBMED   11742537
REFERENCE   8  (bases 1 to 1571)
  AUTHORS   Faura M, Renau-Piqueras J, Bachs O and Bosser R.
  TITLE     Differential distribution of heterogeneous nuclear
            ribonucleoproteins in rat tissues
  JOURNAL   Biochem Biophys Res Commun 217 (2), 554-560 (1995)
   PUBMED   7503735
REFERENCE   9  (bases 1 to 1571)
  AUTHORS   Ehrenman K, Long L, Wagner BJ and Brewer G.
  TITLE     Characterization of cDNAs encoding the murine A+U-rich RNA-binding
            protein AUF1
  JOURNAL   Gene 149 (2), 315-319 (1994)
   PUBMED   7959009
REFERENCE   10 (bases 1 to 1571)
  AUTHORS   Ishikawa F, Matunis MJ, Dreyfuss G and Cech TR.
  TITLE     Nuclear proteins that bind the pre-mRNA 3' splice site sequence
            r(UUAG/G) and the human telomeric DNA sequence d(TTAGGG)n
  JOURNAL   Mol Cell Biol 13 (7), 4301-4310 (1993)
   PUBMED   8321232
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CO567918.1, AB046617.1 and CB798484.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            CDS exon combination :: AB046617.1 [ECO:0000331]
            RNAseq introns       :: single sample supports all introns
                                    SAMD00132261, SAMD00132262 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-436               CO567918.1         1-436
            437-1200            AB046617.1         152-915
            1201-1571           CB798484.1         23-393
FEATURES             Location/Qualifiers
     source          1..1571
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="14"
                     /map="14p22"
     gene            1..1571
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /note="heterogeneous nuclear ribonucleoprotein D"
                     /db_xref="GeneID:79256"
                     /db_xref="RGD:620365"
     exon            1..512
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    187..189
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /note="upstream in-frame stop codon"
     CDS             286..1200
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /note="isoform c is encoded by transcript variant 3;
                     heterogeneous nuclear ribonucleoprotein D0; hnRNP D0;
                     AU-rich element RNA-binding protein 1; AU-rich element
                     RNA-binding factor 1; RNA binding protein p45AUF1"
                     /codon_start=1
                     /product="heterogeneous nuclear ribonucleoprotein D0
                     isoform c"
                     /protein_id="NP_001076009.1"
                     /db_xref="GeneID:79256"
                     /db_xref="RGD:620365"
                     /translation="
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAQGAAAAAGSGSGGGSAPGGTEGGSTEAEGAKIDASKNEEDEGHSNSSPRHTEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGDVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVSRRGGHQNSYKPY"
     misc_feature    <448..513
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /note="CBFNT (NUC161) domain; Region: CBFNT; pfam08143"
                     /db_xref="CDD:311868"
     misc_feature    574..795
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /note="RNA recognition motif 1 (RRM1) found in
                     heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and
                     similar proteins; Region: RRM1_hnRNPD; cd12756"
                     /db_xref="CDD:410150"
     misc_feature    826..1050
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /note="RNA recognition motif 2 (RRM2) found in
                     heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and
                     similar proteins; Region: RRM2_hnRNPD; cd12583"
                     /db_xref="CDD:241027"
     misc_feature    order(826..828,832..834,838..843,913..924,928..933,
                     940..948,952..954,958..960,1009..1011,1030..1038,
                     1042..1050)
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:241027"
     exon            513..569
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /inference="alignment:Splign:2.1.0"
     exon            570..738
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /inference="alignment:Splign:2.1.0"
     exon            739..900
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /inference="alignment:Splign:2.1.0"
     exon            901..1032
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /inference="alignment:Splign:2.1.0"
     exon            1033..1132
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /inference="alignment:Splign:2.1.0"
     exon            1133..1230
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /inference="alignment:Splign:2.1.0"
     exon            1231..1558
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gcggcggcgccattaaagcgaggaggaggcgagagtggccgccgctgctacttattcttttttagtgcagccggggagagtgagagtgcgcgctgcgcgagagtgggaggcgaggggggcaggccggggagaggcgcaggagcctttgcagccacgcgcgcgccttgtcttgtgtgcctcgcgaggtagagcgggcgcgcggcggcggcggggattactttgctgctagtttcggttcgcggcggcggcgggtgtcgtctcggcggcggcggaggcagtagcactatgtcggaggagcagttcggaggggacggggcggcggcggcggcaacggcggcggtaggcggctcggcgggcgagcaggagggagccatggtggcggcggcgcagggggcagcggcggcggcgggaagcgggagcggcggcggctctgcgcccggaggcaccgaaggaggcagcaccgaggcagagggagcgaagatcgacgccagtaagaatgaggaggatgaaggccattcaaactcctccccacgacacactgaagcagcgacggcacagcgggaagaatggaaaatgtttataggaggccttagctgggacaccacaaagaaagacctgaaggactacttttccaaatttggggacgttgtagactgcactctgaagttagatcctatcacagggcgatcaaggggttttggctttgtgctatttaaagagtcggagagtgtagataaggtcatggatcagaaagaacataaattgaatgggaaagtcattgatcctaaaagggccaaagccatgaaaacaaaagagcccgtcaaaaaaatttttgttggtggcctttctccagacacacctgaagaaaaaataagagagtactttggtggttttggtgaggttgaatccatagagctgcctatggacaacaagaccaataagaggcgtgggttctgtttcattacctttaaggaagaggaaccagtgaagaagataatggagaagaaataccacaatgttggtcttagtaaatgtgaaataaaagtagccatgtcgaaggagcagtatcagcagcagcagcagtggggatctagaggagggtttgcaggaagagctcgcggaagaggcggtgatcagcagagtggttatgggaaagtatccagacgaggtggtcatcaaaatagctacaaaccatactaaattattccatttgcaacttatccccaacaggtggtgaagcagtattttccaatttgaagattcatttgaaggtggctcctgccacctgctaatagcagttcaaactaaattttttctatcaagttcccgaatggaagtatgacgttgggtccctctgaagtttaattctgagttctcattaaaagaatttgctttcattgttttatttcttaattgctatgcttcagtatcaatttgtgttttatgcccccctcccccccagtattgtagagcaagtcttgtgttacaagcccagtgtgacagtgtcatgatgtagtagtgtcttactggttttttaataaatccttttgtataaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]