GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-11-01 07:28:20, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_001004224            1231 bp    mRNA    linear   ROD 03-APR-2024
DEFINITION  Rattus norvegicus B-cell receptor-associated protein 31 (Bcap31),
            mRNA.
ACCESSION   NM_001004224 XM_215226
VERSION     NM_001004224.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1231)
  AUTHORS   Li,Y., Jain,N., Limpanawat,S., To,J., Quistgaard,E.M., Nordlund,P.,
            Thanabalu,T. and Torres,J.
  TITLE     Interaction between human BAP31 and respiratory syncytial virus
            small hydrophobic (SH) protein
  JOURNAL   Virology 482, 105-110 (2015)
   PUBMED   25854864
REFERENCE   2  (bases 1 to 1231)
  AUTHORS   Zhang,C., Kho,Y.S., Wang,Z., Chiang,Y.T., Ng,G.K., Shaw,P.C.,
            Wang,Y. and Qi,R.Z.
  TITLE     Transmembrane and coiled-coil domain family 1 is a novel protein of
            the endoplasmic reticulum
  JOURNAL   PLoS One 9 (1), e85206 (2014)
   PUBMED   24454821
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1231)
  AUTHORS   Cacciagli,P., Sutera-Sardo,J., Borges-Correia,A., Roux,J.C.,
            Dorboz,I., Desvignes,J.P., Badens,C., Delepine,M., Lathrop,M.,
            Cau,P., Levy,N., Girard,N., Sarda,P., Boespflug-Tanguy,O. and
            Villard,L.
  TITLE     Mutations in BCAP31 cause a severe X-linked phenotype with
            deafness, dystonia, and central hypomyelination and disorganize the
            Golgi apparatus
  JOURNAL   Am J Hum Genet 93 (3), 579-586 (2013)
   PUBMED   24011989
REFERENCE   4  (bases 1 to 1231)
  AUTHORS   Iwasawa,R., Mahul-Mellier,A.L., Datler,C., Pazarentzos,E. and
            Grimm,S.
  TITLE     Fis1 and Bap31 bridge the mitochondria-ER interface to establish a
            platform for apoptosis induction
  JOURNAL   EMBO J 30 (3), 556-568 (2011)
   PUBMED   21183955
REFERENCE   5  (bases 1 to 1231)
  AUTHORS   Ghosh,D., Lippert,D., Krokhin,O., Cortens,J.P. and Wilkins,J.A.
  TITLE     Defining the membrane proteome of NK cells
  JOURNAL   J Mass Spectrom 45 (1), 1-25 (2010)
   PUBMED   19946888
REFERENCE   6  (bases 1 to 1231)
  AUTHORS   Pang,A.L., Taylor,H.C., Johnson,W., Alexander,S., Chen,Y., Su,Y.A.,
            Li,X., Ravindranath,N., Dym,M., Rennert,O.M. and Chan,W.Y.
  TITLE     Identification of differentially expressed genes in mouse
            spermatogenesis
  JOURNAL   J Androl 24 (6), 899-911 (2003)
   PUBMED   14581517
REFERENCE   7  (bases 1 to 1231)
  AUTHORS   Bell,A.W., Ward,M.A., Blackstock,W.P., Freeman,H.N.,
            Choudhary,J.S., Lewis,A.P., Chotai,D., Fazel,A., Gushue,J.N.,
            Paiement,J., Palcy,S., Chevet,E., Lafreniere-Roula,M., Solari,R.,
            Thomas,D.Y., Rowley,A. and Bergeron,J.J.
  TITLE     Proteomics characterization of abundant Golgi membrane proteins
  JOURNAL   J Biol Chem 276 (7), 5152-5165 (2001)
   PUBMED   11042173
REFERENCE   8  (bases 1 to 1231)
  AUTHORS   Annaert,W.G., Becker,B., Kistner,U., Reth,M. and Jahn,R.
  TITLE     Export of cellubrevin from the endoplasmic reticulum is controlled
            by BAP31
  JOURNAL   J Cell Biol 139 (6), 1397-1410 (1997)
   PUBMED   9396746
REFERENCE   9  (bases 1 to 1231)
  AUTHORS   Li,E., Bestagno,M. and Burrone,O.
  TITLE     Molecular cloning and characterization of a transmembrane surface
            antigen in human cells
  JOURNAL   Eur J Biochem 238 (3), 631-638 (1996)
   PUBMED   8706661
REFERENCE   10 (bases 1 to 1231)
  AUTHORS   Adachi,T., Schamel,W.W., Kim,K.M., Watanabe,T., Becker,B.,
            Nielsen,P.J. and Reth,M.
  TITLE     The specificity of association of the IgD molecule with the
            accessory proteins BAP31/BAP29 lies in the IgD transmembrane
            sequence
  JOURNAL   EMBO J 15 (7), 1534-1541 (1996)
   PUBMED   8612576
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC079182.1.
            
            On Sep 10, 2004 this sequence version replaced XM_215226.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC079182.1, FQ219790.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN16676811 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1231
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="X"
                     /map="Xq37"
     gene            1..1231
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="B-cell receptor-associated protein 31"
                     /db_xref="GeneID:293852"
                     /db_xref="RGD:1302944"
     exon            1..44
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            45..180
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     CDS             89..826
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /codon_start=1
                     /product="B-cell receptor-associated protein 31"
                     /protein_id="NP_001004224.1"
                     /db_xref="GeneID:293852"
                     /db_xref="RGD:1302944"
                     /translation="
MSLQWTAVATFLYAEVFAVLLLCIPFISPKRWQKIFKSRLVELVVTYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGTAEDGGKLDVGSPEMKLEENKILKTDLKKLKDELASTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQASVRGPSDKKEE"
     misc_feature    89..496
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="Bap31/Bap29 transmembrane region; Region: Bap31;
                     pfam05529"
                     /db_xref="CDD:461673"
     misc_feature    662..823
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="Bap31/Bap29 cytoplasmic coiled-coil domain; Region:
                     Bap31_Bap29_C; pfam18035"
                     /db_xref="CDD:465623"
     exon            181..281
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            282..429
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            430..565
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            566..686
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            687..787
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            788..1205
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gagtttggtagttgcagtggggcgtgcgcgtaggctgaaactcggaaacaagctcctatccatctgttggaaacctttaagtcacaggatgagtctgcagtggactgcagttgccaccttcctctacgcagaggtctttgctgtgttgcttctctgcattcccttcatttctcccaaaagatggcagaagatttttaaatctcggctggttgagttggtagtgacctatggcaacactttctttgtggttctcatcgtcatccttgtgctgttggtcattgatgctgtacgtgagatccggaaatatgatgatgtaacagaaaaggtgaacctccagaacaatccaggtgccatggagcacttccacatgaagcttttccgtgctcagaggaatctctatattgctggcttttccttgctgctgtccttcctgcttagacgcctggtgactctcatctcccagcaggccacactgctggcctccaatgaagcctttaaaaagcaggcagaaagtgccagtgaggcagccaagaaatacatggaggagaatgatcagctaaagaagggaactgctgaggatggaggcaagttggatgttgggagtcctgaaatgaagttagaggagaacaagatcctgaagactgatctgaagaagctaaaagatgagctggccagcaccaagaaaaaacttgagaaagctgaaaacgaggctctggctatgcagaagcagtctgagggccttaccaaagaatatgaccgtctgctagaagagcacgccaagctgcaggcctcagtacgtggtccctcagacaagaaggaggagtaaagacttggtttttccctgcctgtagctggcttatacttgacccatgcttactgcttccttggagcccagcctgtccctctggtacttggtttattcccttccatttccccaattttcttccatggcttatagatcattttggccccattacacatactactcttataccaaaaaggacctgattgttgttcattcacagtaattttgccactgttctgcctggccagggcactttccactcctagaagtgtagaaaagcactggtgacctgggctgcacttgtactccattttattttgccatgtatcctaaaagaggctgctgttaagcaggtcaactgttttatcctgaggggaataaatgttgttatgttacaaggaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]