2025-09-19 06:20:42, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_001004224 1231 bp mRNA linear ROD 03-APR-2024 DEFINITION Rattus norvegicus B-cell receptor-associated protein 31 (Bcap31), mRNA. ACCESSION NM_001004224 XM_215226 VERSION NM_001004224.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1231) AUTHORS Li,Y., Jain,N., Limpanawat,S., To,J., Quistgaard,E.M., Nordlund,P., Thanabalu,T. and Torres,J. TITLE Interaction between human BAP31 and respiratory syncytial virus small hydrophobic (SH) protein JOURNAL Virology 482, 105-110 (2015) PUBMED 25854864 REFERENCE 2 (bases 1 to 1231) AUTHORS Zhang,C., Kho,Y.S., Wang,Z., Chiang,Y.T., Ng,G.K., Shaw,P.C., Wang,Y. and Qi,R.Z. TITLE Transmembrane and coiled-coil domain family 1 is a novel protein of the endoplasmic reticulum JOURNAL PLoS One 9 (1), e85206 (2014) PUBMED 24454821 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1231) AUTHORS Cacciagli,P., Sutera-Sardo,J., Borges-Correia,A., Roux,J.C., Dorboz,I., Desvignes,J.P., Badens,C., Delepine,M., Lathrop,M., Cau,P., Levy,N., Girard,N., Sarda,P., Boespflug-Tanguy,O. and Villard,L. TITLE Mutations in BCAP31 cause a severe X-linked phenotype with deafness, dystonia, and central hypomyelination and disorganize the Golgi apparatus JOURNAL Am J Hum Genet 93 (3), 579-586 (2013) PUBMED 24011989 REFERENCE 4 (bases 1 to 1231) AUTHORS Iwasawa,R., Mahul-Mellier,A.L., Datler,C., Pazarentzos,E. and Grimm,S. TITLE Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction JOURNAL EMBO J 30 (3), 556-568 (2011) PUBMED 21183955 REFERENCE 5 (bases 1 to 1231) AUTHORS Ghosh,D., Lippert,D., Krokhin,O., Cortens,J.P. and Wilkins,J.A. TITLE Defining the membrane proteome of NK cells JOURNAL J Mass Spectrom 45 (1), 1-25 (2010) PUBMED 19946888 REFERENCE 6 (bases 1 to 1231) AUTHORS Pang,A.L., Taylor,H.C., Johnson,W., Alexander,S., Chen,Y., Su,Y.A., Li,X., Ravindranath,N., Dym,M., Rennert,O.M. and Chan,W.Y. TITLE Identification of differentially expressed genes in mouse spermatogenesis JOURNAL J Androl 24 (6), 899-911 (2003) PUBMED 14581517 REFERENCE 7 (bases 1 to 1231) AUTHORS Bell,A.W., Ward,M.A., Blackstock,W.P., Freeman,H.N., Choudhary,J.S., Lewis,A.P., Chotai,D., Fazel,A., Gushue,J.N., Paiement,J., Palcy,S., Chevet,E., Lafreniere-Roula,M., Solari,R., Thomas,D.Y., Rowley,A. and Bergeron,J.J. TITLE Proteomics characterization of abundant Golgi membrane proteins JOURNAL J Biol Chem 276 (7), 5152-5165 (2001) PUBMED 11042173 REFERENCE 8 (bases 1 to 1231) AUTHORS Annaert,W.G., Becker,B., Kistner,U., Reth,M. and Jahn,R. TITLE Export of cellubrevin from the endoplasmic reticulum is controlled by BAP31 JOURNAL J Cell Biol 139 (6), 1397-1410 (1997) PUBMED 9396746 REFERENCE 9 (bases 1 to 1231) AUTHORS Li,E., Bestagno,M. and Burrone,O. TITLE Molecular cloning and characterization of a transmembrane surface antigen in human cells JOURNAL Eur J Biochem 238 (3), 631-638 (1996) PUBMED 8706661 REFERENCE 10 (bases 1 to 1231) AUTHORS Adachi,T., Schamel,W.W., Kim,K.M., Watanabe,T., Becker,B., Nielsen,P.J. and Reth,M. TITLE The specificity of association of the IgD molecule with the accessory proteins BAP31/BAP29 lies in the IgD transmembrane sequence JOURNAL EMBO J 15 (7), 1534-1541 (1996) PUBMED 8612576 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC079182.1. On Sep 10, 2004 this sequence version replaced XM_215226.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC079182.1, FQ219790.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN16676811 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1231 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="X" /map="Xq37" gene 1..1231 /gene="Bcap31" /gene_synonym="Bap31" /note="B-cell receptor-associated protein 31" /db_xref="GeneID:293852" /db_xref="RGD:1302944" exon 1..44 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 45..180 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" CDS 89..826 /gene="Bcap31" /gene_synonym="Bap31" /codon_start=1 /product="B-cell receptor-associated protein 31" /protein_id="NP_001004224.1" /db_xref="GeneID:293852" /db_xref="RGD:1302944" /translation="
MSLQWTAVATFLYAEVFAVLLLCIPFISPKRWQKIFKSRLVELVVTYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGTAEDGGKLDVGSPEMKLEENKILKTDLKKLKDELASTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQASVRGPSDKKEE"
misc_feature 89..496 /gene="Bcap31" /gene_synonym="Bap31" /note="Bap31/Bap29 transmembrane region; Region: Bap31; pfam05529" /db_xref="CDD:461673" misc_feature 662..823 /gene="Bcap31" /gene_synonym="Bap31" /note="Bap31/Bap29 cytoplasmic coiled-coil domain; Region: Bap31_Bap29_C; pfam18035" /db_xref="CDD:465623" exon 181..281 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 282..429 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 430..565 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 566..686 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 687..787 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 788..1205 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" ORIGIN
gagtttggtagttgcagtggggcgtgcgcgtaggctgaaactcggaaacaagctcctatccatctgttggaaacctttaagtcacaggatgagtctgcagtggactgcagttgccaccttcctctacgcagaggtctttgctgtgttgcttctctgcattcccttcatttctcccaaaagatggcagaagatttttaaatctcggctggttgagttggtagtgacctatggcaacactttctttgtggttctcatcgtcatccttgtgctgttggtcattgatgctgtacgtgagatccggaaatatgatgatgtaacagaaaaggtgaacctccagaacaatccaggtgccatggagcacttccacatgaagcttttccgtgctcagaggaatctctatattgctggcttttccttgctgctgtccttcctgcttagacgcctggtgactctcatctcccagcaggccacactgctggcctccaatgaagcctttaaaaagcaggcagaaagtgccagtgaggcagccaagaaatacatggaggagaatgatcagctaaagaagggaactgctgaggatggaggcaagttggatgttgggagtcctgaaatgaagttagaggagaacaagatcctgaagactgatctgaagaagctaaaagatgagctggccagcaccaagaaaaaacttgagaaagctgaaaacgaggctctggctatgcagaagcagtctgagggccttaccaaagaatatgaccgtctgctagaagagcacgccaagctgcaggcctcagtacgtggtccctcagacaagaaggaggagtaaagacttggtttttccctgcctgtagctggcttatacttgacccatgcttactgcttccttggagcccagcctgtccctctggtacttggtttattcccttccatttccccaattttcttccatggcttatagatcattttggccccattacacatactactcttataccaaaaaggacctgattgttgttcattcacagtaattttgccactgttctgcctggccagggcactttccactcctagaagtgtagaaaagcactggtgacctgggctgcacttgtactccattttattttgccatgtatcctaaaagaggctgctgttaagcaggtcaactgttttatcctgaggggaataaatgttgttatgttacaaggaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]