GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-09-28 02:27:59, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_036159030             727 bp    mRNA    linear   ROD 07-FEB-2024
DEFINITION  PREDICTED: Mus musculus predicted pseudogene 7206 (Gm7206), mRNA.
ACCESSION   XM_036159030
VERSION     XM_036159030.1
DBLINK      BioProject: PRJNA169
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_000080.7) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_000001635.27-RS_2024_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           RefSeqFE; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/01/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 5% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..727
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6J"
                     /db_xref="taxon:10090"
                     /chromosome="14"
     gene            1..727
                     /gene="Gm7206"
                     /note="predicted pseudogene 7206; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1318
                     long SRA reads, 11 Proteins, and 94% coverage of the
                     annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:101056029"
                     /db_xref="MGI:MGI:3646634"
     CDS             1..624
                     /gene="Gm7206"
                     /codon_start=1
                     /product="60S ribosomal protein L9-like"
                     /protein_id="XP_036014923.1"
                     /db_xref="GeneID:101056029"
                     /db_xref="MGI:MGI:3646634"
                     /translation="
MSIEYYTTLRCSVTPPFVNPEPFLLLPKETQLHVDVIEVPPQSPPGALHNDCAPLQSDFDILWNVHSLIAENGLHPRSRWGPTVRTICSHVQNMIKGVMLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRTGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQQADE"
     misc_feature    <247..615
                     /gene="Gm7206"
                     /note="60S ribosomal protein L6; Provisional; Region:
                     PTZ00027"
                     /db_xref="CDD:240234"
ORIGIN      
atgagtattgagtactatacaacattgagatgttctgttaccccaccatttgtcaacccggagccttttcttcttcttcccaaggagactcagctccacgttgatgtgattgaagtccctccgcagagtccccctggggcccttcacaatgactgtgcgccccttcagagtgatttcgacattctctggaatgtccacagtctgattgctgagaatggtcttcatcctcgcagtagatggggccccaccgtcaggaccatctgcagtcatgttcagaacatgatcaaaggtgtcatgctgggcttccgatacaagatgcggtctgtgtacgctcacttccccatcaacgtcgtcatccaggagaatggctctttggttgaaatccgaaatttcttgggtgaaaaatacatccgcagggttcggatgaggacaggtgtggcttgttctgtctctcaagcccagaaggatgagttaatccttgaaggaaatgacattgaacttgtttcaaattcagctgccctgattcagcaagccacaacagttaaaaacaaggatatcaggaagtttttggacggcatctatgtgtctgagaagggaactgtgcagcagcaggctgacgagtgaggaggcctcagttcctggccccagaaacgagatcctgaccacaagaacaatttgggctcttttgggagaataaaagacttatatattgaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]