ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-09-28 02:28:09, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_011243194 962 bp mRNA linear ROD 07-FEB-2024
DEFINITION PREDICTED: Mus musculus sulfotransferase family 3A, member 1
(Sult3a1), transcript variant X1, mRNA.
ACCESSION XM_011243194
VERSION XM_011243194.1
DBLINK BioProject: PRJNA169
KEYWORDS RefSeq.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_000076.7) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Status :: Updated annotation
Annotation Name :: GCF_000001635.27-RS_2024_02
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 10.2
Annotation Method :: Best-placed RefSeq; Gnomon;
RefSeqFE; cmsearch; tRNAscan-SE
Features Annotated :: Gene; mRNA; CDS; ncRNA
Annotation Date :: 02/01/2024
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..962
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6J"
/db_xref="taxon:10090"
/chromosome="10"
gene 1..962
/gene="Sult3a1"
/gene_synonym="ST3A1; Sult-x2; Sultx2"
/note="sulfotransferase family 3A, member 1; Derived by
automated computational analysis using gene prediction
method: Gnomon. Supporting evidence includes similarity
to: 4 Proteins, and 100% coverage of the annotated genomic
feature by RNAseq alignments, including 1 sample with
support for all annotated introns"
/db_xref="GeneID:57430"
/db_xref="MGI:MGI:1931469"
CDS 42..923
/gene="Sult3a1"
/gene_synonym="ST3A1; Sult-x2; Sultx2"
/codon_start=1
/product="amine sulfotransferase isoform X1"
/protein_id="XP_011241496.1"
/db_xref="GeneID:57430"
/db_xref="MGI:MGI:1931469"
/translation="
MDNKDEYLLNFKGYNFQKTLVKMEVVENIENYEIRDDDIFIVTYPKSGTIWTQQILSLIYFEGHRNRTENIETIDRAPFFEYNIHKLDYAKMPSPRIFSSHIPYYLVPKGLKDKKAKILYIYRNPKDVLISYFHFSNLMLIFQNPDTVESFMQTFLDGDVVGSLWFDHIRGWYEHRHDFNIMFMSFEDMKKDLRSSVLKICSFLEKELSEEDVDAVVRQATFQKMKADPRANYEHIIKDELGTRNEMGSFLRKGVVGDWKHYLTVDQSERFDKIFHRNMKNIPLKFIWDINEE"
misc_feature 147..881
/gene="Sult3a1"
/gene_synonym="ST3A1; Sult-x2; Sultx2"
/note="Sulfotransferase domain; Region: Sulfotransfer_1;
pfam00685"
/db_xref="CDD:425820"
ORIGIN
ctttcacttgcttggttagagacacaccaaggtaacaaattatggacaataaagatgaatatttgcttaacttcaaaggctataattttcagaaaactttagttaaaatggaagtagtggaaaatatagaaaattatgaaattcgagatgatgacatcttcattgtcacatatccaaagtctggtaccatctggacccagcagatcctttccttgatttattttgagggtcatcggaacagaactgaaaacatcgaaacaatagatagagcaccattttttgagtacaatattcacaaattagactatgccaaaatgccatcacctcgcatcttcagttcccacattccatattacttagtaccaaaaggtctcaaggacaaaaaagccaaaattctttatatctacagaaatcctaaagatgttttgatctcctattttcatttctcaaatttgatgcttatatttcaaaatccagacactgtagaaagttttatgcaaacatttctagatggagatgtggtaggaagcctttggtttgaccacataagaggctggtatgaacacagacatgatttcaatattatgttcatgagctttgaagacatgaagaaggacctcagaagctcagtgcttaaaatctgcagttttctggagaaagaactgagtgaagaagatgtggatgctgttgtgagacaagctacctttcagaaaatgaaagctgacccaagagcaaactatgaacacattataaaagatgaactcggaacaagaaatgagatgggaagtttccttcgcaaaggtgttgttggagactggaaacattatttgactgtggatcagagtgaaagatttgacaagatatttcacagaaacatgaaaaacatccccttaaaattcatctgggacataaatgaggagtagaatattaatcaccacgtgaataaaccatatgaaaatgta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]