2024-07-03 23:02:27, GGRNA.v2 : RefSeq release 224 (May, 2024)
LOCUS NM_205822 735 bp mRNA linear ROD 13-AUG-2022 DEFINITION Mus musculus oocyte maturation, beta (Omt2b), mRNA. ACCESSION NM_205822 XM_356169 VERSION NM_205822.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 735) AUTHORS Gindi N, Grossman H, Bar-Joseph H, Miller I, Nemerovsky L, Hadas R, Nevo N, Galiani D, Dekel N and Shalgi R. TITLE Fyn and argonaute 2 participate in maternal-mRNA degradation during mouse oocyte maturation JOURNAL Cell Cycle 21 (8), 792-804 (2022) PUBMED 35104175 REFERENCE 2 (bases 1 to 735) AUTHORS Popova NV and Morris RJ. TITLE Genetic regulation of mouse stem cells: identification of two keratinocyte stem cell regulatory loci JOURNAL Curr Top Microbiol Immunol 280, 111-137 (2004) PUBMED 14594209 REFERENCE 3 (bases 1 to 735) AUTHORS Popova NV, Teti KA, Wu KQ and Morris RJ. TITLE Identification of two keratinocyte stem cell regulatory loci implicated in skin carcinogenesis JOURNAL Carcinogenesis 24 (3), 417-425 (2003) PUBMED 12663500 REFERENCE 4 (bases 1 to 735) AUTHORS West MF, Verrotti AC, Salles FJ, Tsirka SE and Strickland S. TITLE Isolation and characterization of two novel, cytoplasmically polyadenylated, oocyte-specific, mouse maternal RNAs JOURNAL Dev Biol 175 (1), 132-141 (1996) PUBMED 8608859 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC138587.11, CO795725.1 and AU022354.1. On Apr 13, 2007 this sequence version replaced NM_205822.1. ##Evidence-Data-START## Transcript exon combination :: AU022354.1, BG071097.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849374, SAMN00849383 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-235 AC138587.11 111530-111764 236-711 CO795725.1 127-602 712-735 AU022354.1 1-24 c FEATURES Location/Qualifiers source 1..735 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="9" /map="9 43.65 cM" gene 1..735 /gene="Omt2b" /gene_synonym="Mosg; OM2b" /note="oocyte maturation, beta" /db_xref="GeneID:382088" /db_xref="MGI:MGI:106619" exon 1..235 /gene="Omt2b" /gene_synonym="Mosg; OM2b" /inference="alignment:Splign:2.1.0" CDS 109..468 /gene="Omt2b" /gene_synonym="Mosg; OM2b" /codon_start=1 /product="oocyte maturation, beta" /protein_id="NP_991391.2" /db_xref="CCDS:CCDS52869.1" /db_xref="GeneID:382088" /db_xref="MGI:MGI:106619" /translation="
MMSQLHICYGPVCEMQHHLPSFLDPLEFVIVYLETWVYKGLFDLRPELLLYFLNMHVLITSDGDLSETVLYIYGSKGIRIFAMFVIVSLACNLRTKRNRARAWARGLQSPVWWNRRYFI"
exon 236..406 /gene="Omt2b" /gene_synonym="Mosg; OM2b" /inference="alignment:Splign:2.1.0" exon 407..735 /gene="Omt2b" /gene_synonym="Mosg; OM2b" /inference="alignment:Splign:2.1.0" ORIGIN
agtgtgccttgggggtggggcttgggggtggagagacaggaaagcagacagaaggcagcatttagaagaaggtgtagccaatctgaagatcttttgcagggaagggtgatgatgtctcaacttcacatatgttatggccctgtttgtgagatgcaacatcaccttccatctttcctggaccccctggagtttgtgattgtgtacctagagacctgggtctacaaaggattgtttgatttgaggccggaactattgctatactttttgaatatgcacgttcttattacatctgatggtgatttaagtgaaacagtcctgtacatttatggatccaaagggattaggatctttgcaatgtttgtgattgtgtcgctagcttgcaatctccggaccaagcgaaatcgagccagagcctgggccagaggcctgcaaagccctgtgtggtggaaccggaggtacttcatttaagaggacgcctgtccaggacccgttgttcagatgtcctttgccataatgttaaccttggaacagccttgcctgtggagaagccggcttgaccatgatgccaagttccagatctttttgtgccaggacaggtggggagggggttttaccagtgttcttaactatactgtgatttttattattgccatgtccagcttttaagtggggttttaacggttttataataaataaaagtttcaggcagaagaaaggaccatgtgtttgacttac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]