ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-11-01 20:31:27, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_030057 1283 bp mRNA linear ROD 23-JUN-2025
DEFINITION Mus musculus trafficking protein particle complex 6B (Trappc6b),
transcript variant 1, mRNA.
ACCESSION NM_030057 XM_127025
VERSION NM_030057.3
KEYWORDS RefSeq; RefSeq Select.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 1283)
AUTHORS Kim,J.J., Lipatova,Z. and Segev,N.
TITLE TRAPP Complexes in Secretion and Autophagy
JOURNAL Front Cell Dev Biol 4, 20 (2016)
PUBMED 27066478
REMARK Review article
Publication Status: Online-Only
REFERENCE 2 (bases 1 to 1283)
AUTHORS Pan,J., Mor,G., Ju,W., Zhong,J., Luo,X., Aldo,P.B., Zhong,M.,
Yu,Y., Jenkins,E.C., Brown,W.T. and Zhong,N.
TITLE Viral Infection-Induced Differential Expression of LncRNAs
Associated with Collagen in Mouse Placentas and Amniotic Sacs
JOURNAL Am J Reprod Immunol 74 (3), 237-257 (2015)
PUBMED 26073538
REFERENCE 3 (bases 1 to 1283)
AUTHORS Hughes,D.S., Keynes,R.J. and Tannahill,D.
TITLE Extensive molecular differences between anterior- and
posterior-half-sclerotomes underlie somite polarity and spinal
nerve segmentation
JOURNAL BMC Dev Biol 9, 30 (2009)
PUBMED 19463158
REMARK Publication Status: Online-Only
REFERENCE 4 (bases 1 to 1283)
AUTHORS Evsikov,A.V., Graber,J.H., Brockman,J.M., Hampl,A., Holbrook,A.E.,
Singh,P., Eppig,J.J., Solter,D. and Knowles,B.B.
TITLE Cracking the egg: molecular dynamics and evolutionary aspects of
the transition from the fully grown oocyte to embryo
JOURNAL Genes Dev 20 (19), 2713-2727 (2006)
PUBMED 17015433
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
DV660612.1, AK020026.1 and CO039101.1.
On Apr 16, 2015 this sequence version replaced NM_030057.2.
Transcript Variant: This variant (1) encodes the longest isoform
(1).
##Evidence-Data-START##
Transcript exon combination :: AK046610.1, BC031464.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN00849375, SAMN00849381
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on conservation, expression,
longest protein
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-68 DV660612.1 16-83
69-1076 AK020026.1 38-1045
1077-1283 CO039101.1 1-207 c
FEATURES Location/Qualifiers
source 1..1283
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6"
/db_xref="taxon:10090"
/chromosome="12"
/map="12 25.99 cM"
gene 1..1283
/gene="Trappc6b"
/gene_synonym="5830498C14Rik"
/note="trafficking protein particle complex 6B"
/db_xref="GeneID:78232"
/db_xref="MGI:MGI:1925482"
exon 1..317
/gene="Trappc6b"
/gene_synonym="5830498C14Rik"
/inference="alignment:Splign:2.1.0"
misc_feature 198..200
/gene="Trappc6b"
/gene_synonym="5830498C14Rik"
/note="upstream in-frame stop codon"
CDS 237..713
/gene="Trappc6b"
/gene_synonym="5830498C14Rik"
/note="isoform 1 is encoded by transcript variant 1;
trafficking protein particle complex subunit 6B; TRAPP
complex subunit 6B"
/codon_start=1
/product="trafficking protein particle complex subunit 6B
isoform 1"
/protein_id="NP_084333.1"
/db_xref="CCDS:CCDS25932.1"
/db_xref="GeneID:78232"
/db_xref="MGI:MGI:1925482"
/translation="
MADEALFLLLHNEMVSGVYKSAEQGEVENGRCVTKLESMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLIQLSAGKQYLEHASKYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKFQVMIQKL"
misc_feature 243..704
/gene="Trappc6b"
/gene_synonym="5830498C14Rik"
/note="Trs33 subunit of the TRAPP complex; Region:
TRAPPC6A_Trs33; cd14944"
/db_xref="CDD:271347"
misc_feature order(249..251,258..260,270..272,543..548,576..578,
588..590)
/gene="Trappc6b"
/gene_synonym="5830498C14Rik"
/note="synbindin interface [polypeptide binding]; other
site"
/db_xref="CDD:271347"
misc_feature order(252..257,261..269,273..278,285..287,339..341,
351..353,360..365,372..377,384..386,459..461,468..470,
528..530,597..599)
/gene="Trappc6b"
/gene_synonym="5830498C14Rik"
/note="BET3 interface [polypeptide binding]; other site"
/db_xref="CDD:271347"
exon 318..385
/gene="Trappc6b"
/gene_synonym="5830498C14Rik"
/inference="alignment:Splign:2.1.0"
exon 386..503
/gene="Trappc6b"
/gene_synonym="5830498C14Rik"
/inference="alignment:Splign:2.1.0"
exon 504..587
/gene="Trappc6b"
/gene_synonym="5830498C14Rik"
/inference="alignment:Splign:2.1.0"
exon 588..681
/gene="Trappc6b"
/gene_synonym="5830498C14Rik"
/inference="alignment:Splign:2.1.0"
exon 682..1266
/gene="Trappc6b"
/gene_synonym="5830498C14Rik"
/inference="alignment:Splign:2.1.0"
regulatory 1207..1212
/regulatory_class="polyA_signal_sequence"
/gene="Trappc6b"
/gene_synonym="5830498C14Rik"
/note="hexamer: AATACA"
polyA_site 1228
/gene="Trappc6b"
/gene_synonym="5830498C14Rik"
/note="major polyA site"
ORIGIN
ggaagtggctcaggctccacgcccagcgctatagtcttggcagagtgtggggctgtcacagggtctctagggcccagtggcggcggccccggggaggggcgcggtccacggcggccttccgcggccttaggacccgggtaggccgctgagcacggcgtgcggtgggcgcggggtaacgggaacctcgagtcccgcactgatcggagccgactcggcgctggagggatcggcgggaaatggcggacgaggcgttgtttttgcttctccataacgagatggtgtccggagtgtacaagtccgccgagcagggggaagtggaaaatggaaggtgtgttactaagctggagagcatggggttccgagtggggcaaggactgatagaaaggtttacgaaagatactgcaaggttcaaggatgaattagacatcatgaagttcatctgtaaagatttttggactacagtattcaagaaacagattgacaatctgaggacaaatcatcagggcatatatgtacttcaggacaacaaatttcgactactcattcagctgtctgcaggaaaacagtatttagaacatgcgtccaagtatctagcattcacatgtggcttaatcagaggtggtttgtcgaacttgggaataaaaagtattgtaacagctgaagtctcttcaatgcctgcctgcaaatttcaggtgatgatacagaagctgtagagcgagctggcgactcctgggcagagcgttgcacatcctgatttcacctcatcgttggttatctgcgttggagcaaatcgttatctcaccagagtcacatagaccaaatcaaagtagacacaggtcctttgaccatgacagaaactgactgacctattcagtgatttcagagaactagacaccaagatgcaaggctcttcattttaaacatctttatttccataggtgattagcatttaaccatcaataggaagtgaaactcagggtgtgttgaattgctgtattaaaaaaaatgcaccaatcagaatagtttgtgttcaaatgaccaaaatttgttgaactataaatctgttttagttatttaaaaaagcaaaccactatgttaaattaagcttaatttttattgtattgcttataatttatttctgtcgagagaattcatatgcttatgtaaggatatcatttatacattgtgtatatatgtgtatatataaatacatgcattactgtctaaattacttgaaagtttattttaatagacttgagtccttgaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]