LOCUS       NM_026481               1040 bp    mRNA    linear   ROD 20-JAN-2026
DEFINITION  Mus musculus tubulin polymerization-promoting protein family member
            3 (Tppp3), mRNA.
ACCESSION   NM_026481
VERSION     NM_026481.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1040)
  AUTHORS   Sakai,T., Kawakita,M., Seki,A., Takaoka,K., Kurata,M., Torikai,J.,
            Atsumi,S., Yawata,K., Noi,K., Fukutani,Y., Noguchi,K., Kiyokawa,H.,
            Morimoto,M., Takeuchi,E., Minegishi,K., Aoki,Y., Fujimura,S.,
            Nishizaka,T., Inoue,T., Nagaoka,K., Tsugawa,H., Hayashi,H.,
            Ishiguro,H., Kozono,T., Ohsawa,I., Fujita,Y., Matsunami,H.,
            Hamada,H. and Shinohara,K.
  TITLE     Tppp3 determines basal body positioning and identity of respiratory
            cilia via microtubule assembly and sphingolipid homeostasis
  JOURNAL   Proc Natl Acad Sci U S A 122 (49), e2503931122 (2025)
   PUBMED   41325527
REFERENCE   2  (bases 1 to 1040)
  AUTHORS   Lin,S., Dieterich,C., Britto-Borges,T., Gunther,S., Kreher,S.,
            Eibach,Y., Kuenne,C., Schneider,A. and Braun,T.
  TITLE     Rbpms2 prevents major cardiac defects in cardiomyocyte-specific
            Rbpms-deficient mice
  JOURNAL   Dev Cell 60 (20), 2791-2806 (2025)
   PUBMED   40602408
REFERENCE   3  (bases 1 to 1040)
  AUTHORS   Goto,A., Komura,S., Kato,K., Maki,R., Hirakawa,A., Aoki,H.,
            Tomita,H., Taguchi,J., Ozawa,M., Matsushima,T., Kishida,A.,
            Kimura,T., Asahara,H., Imai,Y., Yamada,Y. and Akiyama,H.
  TITLE     PI3K-Akt signalling regulates Scx-lineage tenocytes and
            Tppp3-lineage paratenon sheath cells in neonatal tendon
            regeneration
  JOURNAL   Nat Commun 16 (1), 3734 (2025)
   PUBMED   40254618
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1040)
  AUTHORS   Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
            Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
            Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
            Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
            Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
            Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
            Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
            Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
            Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
            Jackson,S.P. and Balmus,G.
  CONSRTM   Sanger Mouse Genetics Project
  TITLE     Genetic determinants of micronucleus formation in vivo
  JOURNAL   Nature 627 (8002), 130-136 (2024)
   PUBMED   38355793
REFERENCE   5  (bases 1 to 1040)
  AUTHORS   Cherief,M., Xu,J., Li,Z., Tower,R.J., Ramesh,S., Qin,Q.,
            Gomez-Salazar,M., Yea,J.H., Lee,S., Negri,S., Xu,M., Price,T.,
            Kendal,A.R., Fan,C.M., Clemens,T.L., Levi,B. and James,A.W.
  TITLE     TrkA-mediated sensory innervation of injured mouse tendon supports
            tendon sheath progenitor cell expansion and tendon repair
  JOURNAL   Sci Transl Med 15 (727), eade4619 (2023)
   PUBMED   38117901
REFERENCE   6  (bases 1 to 1040)
  AUTHORS   Liu,W., Watson,S.S., Lan,Y., Keene,D.R., Ovitt,C.E., Liu,H.,
            Schweitzer,R. and Jiang,R.
  TITLE     The atypical homeodomain transcription factor Mohawk controls
            tendon morphogenesis
  JOURNAL   Mol Cell Biol 30 (20), 4797-4807 (2010)
   PUBMED   20696843
REFERENCE   7  (bases 1 to 1040)
  AUTHORS   Zhou,W., Li,J., Wang,X. and Hu,R.
  TITLE     Stable knockdown of TPPP3 by RNA interference in Lewis lung
            carcinoma cell inhibits tumor growth and metastasis
  JOURNAL   Mol Cell Biochem 343 (1-2), 231-238 (2010)
   PUBMED   20571904
  REMARK    GeneRIF: findings suggested that the TPPP3 gene played an important
            role in tumorigenesis and metastasis, and it could potentially
            become a novel target for cancer therapy
REFERENCE   8  (bases 1 to 1040)
  AUTHORS   Staverosky,J.A., Pryce,B.A., Watson,S.S. and Schweitzer,R.
  TITLE     Tubulin polymerization-promoting protein family member 3, Tppp3, is
            a specific marker of the differentiating tendon sheath and synovial
            joints
  JOURNAL   Dev Dyn 238 (3), 685-692 (2009)
   PUBMED   19235716
  REMARK    GeneRIF: onset of Tppp3 expression in joints coincides with
            cavitation, representing a molecular marker that can be used to
            indicate this stage in joint transition in joint differentiation
REFERENCE   9  (bases 1 to 1040)
  AUTHORS   Amanai,M., Brahmajosyula,M. and Perry,A.C.
  TITLE     A restricted role for sperm-borne microRNAs in mammalian
            fertilization
  JOURNAL   Biol Reprod 75 (6), 877-884 (2006)
   PUBMED   16943360
REFERENCE   10 (bases 1 to 1040)
  AUTHORS   Keegan,C.E., Hutz,J.E., Else,T., Adamska,M., Shah,S.P., Kent,A.E.,
            Howes,J.M., Beamer,W.G. and Hammer,G.D.
  TITLE     Urogenital and caudal dysgenesis in adrenocortical dysplasia (acd)
            mice is caused by a splicing mutation in a novel telomeric
            regulator
  JOURNAL   Hum Mol Genet 14 (1), 113-123 (2005)
   PUBMED   15537664
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BF469439.1, AK160507.1 and AW494372.1.
            
            On Aug 15, 2009 this sequence version replaced NM_026481.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC010788.1, AK155018.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849375
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-30                BF469439.1         1-30
            31-1020             AK160507.1         2-991
            1021-1040           AW494372.1         1-20                c
FEATURES             Location/Qualifiers
     source          1..1040
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="8"
                     /map="8 53.04 cM"
     gene            1..1040
                     /gene="Tppp3"
                     /gene_synonym="2700055K07Rik; Ceacam9; CGI-38; mmCGM8"
                     /note="tubulin polymerization-promoting protein family
                     member 3"
                     /db_xref="GeneID:67971"
                     /db_xref="MGI:MGI:1915221"
     exon            1..143
                     /gene="Tppp3"
                     /gene_synonym="2700055K07Rik; Ceacam9; CGI-38; mmCGM8"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    135..137
                     /gene="Tppp3"
                     /gene_synonym="2700055K07Rik; Ceacam9; CGI-38; mmCGM8"
                     /note="upstream in-frame stop codon"
     exon            144..337
                     /gene="Tppp3"
                     /gene_synonym="2700055K07Rik; Ceacam9; CGI-38; mmCGM8"
                     /inference="alignment:Splign:2.1.0"
     CDS             150..680
                     /gene="Tppp3"
                     /gene_synonym="2700055K07Rik; Ceacam9; CGI-38; mmCGM8"
                     /codon_start=1
                     /product="tubulin polymerization-promoting protein family
                     member 3"
                     /protein_id="NP_080757.1"
                     /db_xref="CCDS:CCDS22602.1"
                     /db_xref="GeneID:67971"
                     /db_xref="MGI:MGI:1915221"
                     /translation="

MAASTDIAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLIAGKEPANIGVTKAKTGGAVDRLTDTSKYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK"

     misc_feature    153..155
                     /gene="Tppp3"
                     /gene_synonym="2700055K07Rik; Ceacam9; CGI-38; mmCGM8"
                     /note="N-acetylalanine.
                     /evidence=ECO:0000250|UniProtKB:Q9BW30; propagated from
                     UniProtKB/Swiss-Prot (Q9CRB6.1); acetylation site"
     misc_feature    180..647
                     /gene="Tppp3"
                     /gene_synonym="2700055K07Rik; Ceacam9; CGI-38; mmCGM8"
                     /note="Region: p25-alpha; pfam05517"
                     /db_xref="CDD:461670"
     misc_feature    543..605
                     /gene="Tppp3"
                     /gene_synonym="2700055K07Rik; Ceacam9; CGI-38; mmCGM8"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9CRB6.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            338..491
                     /gene="Tppp3"
                     /gene_synonym="2700055K07Rik; Ceacam9; CGI-38; mmCGM8"
                     /inference="alignment:Splign:2.1.0"
     exon            492..1024
                     /gene="Tppp3"
                     /gene_synonym="2700055K07Rik; Ceacam9; CGI-38; mmCGM8"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1000..1005
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Tppp3"
                     /gene_synonym="2700055K07Rik; Ceacam9; CGI-38; mmCGM8"
                     /note="hexamer: AATAAA"
     polyA_site      1024
                     /gene="Tppp3"
                     /gene_synonym="2700055K07Rik; Ceacam9; CGI-38; mmCGM8"
                     /note="major polyA site"
ORIGIN      

gggataatactacggagccgcccgggctgcagtcccgcccgggagccggcagggagcggagctgtggagcctcctggtctccagcatcagttcctgggtcctgtccgaaggcacgctcaggagcagccaagcggtagaagccgggtggcatggcagcgagcacggacatagctgggctggaggagagcttccggaagtttgccatccatggcgaccccaaggccagcgggcaagagatgaatggcaagaactgggccaagctgtgcaaggactgtaaggtggccgacggaaaggccgtaacgggcaccgacgtcgacatcgtcttctccaaagtcaaggcgaaatctgctagagtaatcaactatgaggagttcaagaaggccctggaagagctggcaactaagcggttcaaggggaagtccaaggaggaggcctttgatgccatctgccagctgatagcgggcaaggaaccggccaacattggcgtcaccaaagctaaaacgggtggtgctgtggaccggctgacggacaccagtaagtatacgggctcccacaaagaacgctttgatgagagcggcaagggaaagggcatcgctggacggcaggacatcctggacgacagtggctacgtgagtgcctacaaaaacgcaggcacctatgacgccaaggtgaagaagtgacacctgccaaagcccccagggaggctgtcccactggaggcccaggcctggggtccagggtcacatggagcaagaaagcctggctccctccctgctggatctgccaccaagagcttcctgcccagtcccagggccatcccatcaggcctctgacccagactgctgtgtcccttcttcctgtctccctgtcatctgtctgggagtcagtgcctatatcctcaccgccccagcctggtcccaggcatggctgactcttgcctgcttttgcctcatatttaagctgctgctctggccaagtgcctaattcttacccagacctcaataaagataccttttgtaccaggaaaaaaaaaaaaaaaaa

//