GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-12 23:09:16, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_021300                886 bp    mRNA    linear   ROD 04-AUG-2023
DEFINITION  Mus musculus reproductive homeobox 4B (Rhox4b), mRNA.
ACCESSION   NM_021300 XM_918433
VERSION     NM_021300.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 886)
  AUTHORS   Beal R, Alonso-Carriazo Fernandez A, Grammatopoulos DK, Matter K
            and Balda MS.
  TITLE     ARHGEF18/p114RhoGEF Coordinates PKA/CREB Signaling and Actomyosin
            Remodeling to Promote Trophoblast Cell-Cell Fusion During Placenta
            Morphogenesis
  JOURNAL   Front Cell Dev Biol 9, 658006 (2021)
   PUBMED   33842485
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 886)
  AUTHORS   Langford MB, Outhwaite JE, Hughes M, Natale DRC and Simmons DG.
  TITLE     Deletion of the Syncytin A receptor Ly6e impairs
            syncytiotrophoblast fusion and placental morphogenesis causing
            embryonic lethality in mice
  JOURNAL   Sci Rep 8 (1), 3961 (2018)
   PUBMED   29500366
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 886)
  AUTHORS   Funato N, Kokubo H, Nakamura M, Yanagisawa H and Saga Y.
  TITLE     Specification of jaw identity by the Hand2 transcription factor
  JOURNAL   Sci Rep 6, 28405 (2016)
   PUBMED   27329940
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 886)
  AUTHORS   Thompson CL, Ng L, Menon V, Martinez S, Lee CK, Glattfelder K,
            Sunkin SM, Henry A, Lau C, Dang C, Garcia-Lopez R, Martinez-Ferre
            A, Pombero A, Rubenstein JLR, Wakeman WB, Hohmann J, Dee N, Sodt
            AJ, Young R, Smith K, Nguyen TN, Kidney J, Kuan L, Jeromin A,
            Kaykas A, Miller J, Page D, Orta G, Bernard A, Riley Z, Smith S,
            Wohnoutka P, Hawrylycz MJ, Puelles L and Jones AR.
  TITLE     A high-resolution spatiotemporal atlas of gene expression of the
            developing mouse brain
  JOURNAL   Neuron 83 (2), 309-323 (2014)
   PUBMED   24952961
REFERENCE   5  (bases 1 to 886)
  AUTHORS   Wiese CB, Ireland S, Fleming NL, Yu J, Valerius MT, Georgas K, Chiu
            HS, Brennan J, Armstrong J, Little MH, McMahon AP and
            Southard-Smith EM.
  TITLE     A genome-wide screen to identify transcription factors expressed in
            pelvic Ganglia of the lower urinary tract
  JOURNAL   Front Neurosci 6, 130 (2012)
   PUBMED   22988430
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 886)
  AUTHORS   Lee WK, Kim YM, Malik N, Ma C and Westphal H.
  TITLE     Cloning and characterization of the 5'-flanking region of the Ehox
            gene
  JOURNAL   Biochem Biophys Res Commun 341 (1), 225-231 (2006)
   PUBMED   16414020
  REMARK    GeneRIF: These results suggest that NFY is an essential regulatory
            factor for Ehox transcriptional activity, which is important for
            the post-implantation stage of the developing embryo.
REFERENCE   7  (bases 1 to 886)
  AUTHORS   Morris L, Gordon J and Blackburn CC.
  TITLE     Identification of a tandem duplicated array in the Rhox alpha locus
            on mouse chromosome X
  JOURNAL   Mamm Genome 17 (2), 178-187 (2006)
   PUBMED   16465597
REFERENCE   8  (bases 1 to 886)
  AUTHORS   Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML,
            Macleod C and Wilkinson MF.
  TITLE     Rhox: a new homeobox gene cluster
  JOURNAL   Cell 120 (3), 369-382 (2005)
   PUBMED   15707895
REFERENCE   9  (bases 1 to 886)
  AUTHORS   Jackson M, Baird JW, Nichols J, Wilkie R, Ansell JD, Graham G and
            Forrester LM.
  TITLE     Expression of a novel homeobox gene Ehox in trophoblast stem cells
            and pharyngeal pouch endoderm
  JOURNAL   Dev Dyn 228 (4), 740-744 (2003)
   PUBMED   14648851
  REMARK    GeneRIF: Ehox is expressed in trophoblast stem cells and pharyngeal
            pouch endoderm
REFERENCE   10 (bases 1 to 886)
  AUTHORS   Jackson M, Baird JW, Cambray N, Ansell JD, Forrester LM and Graham
            GJ.
  TITLE     Cloning and characterization of Ehox, a novel homeobox gene
            essential for embryonic stem cell differentiation
  JOURNAL   J Biol Chem 277 (41), 38683-38692 (2002)
   PUBMED   12087094
  REMARK    GeneRIF: Results suggest that Ehox is a novel homeobox-containing
            gene that is essential for the earliest stages of murine ES cell
            differentiation.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AJ972666.1.
            
            On Mar 7, 2006 this sequence version replaced NM_021300.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AJ972666.1, AF265350.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164134, SAMN01164137
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..886
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 21.73 cM"
     gene            1..886
                     /gene="Rhox4b"
                     /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a"
                     /note="reproductive homeobox 4B"
                     /db_xref="GeneID:57737"
                     /db_xref="MGI:MGI:1930129"
     exon            1..198
                     /gene="Rhox4b"
                     /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a"
                     /inference="alignment:Splign:2.1.0"
     CDS             132..749
                     /gene="Rhox4b"
                     /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a"
                     /note="ES cell derived homeobox containing; reproductive
                     homeobox on X chromosome 4; homeobox protein EHOX"
                     /codon_start=1
                     /product="reproductive homeobox 4B"
                     /protein_id="NP_067275.1"
                     /db_xref="CCDS:CCDS30077.1"
                     /db_xref="GeneID:57737"
                     /db_xref="MGI:MGI:1930129"
                     /translation="
MEHQNTNYLLHEGLGKDKEKLNGGKTQTVLPLDGEGRNEGESVLGQSGAAAVEWDKAEELSGEGGPAAGDADLMDNSNQEDQDTSGSAQEEEKLPEEPVLRDAVVIDKVQPIPVLVSGVRPKSVWVQQRSLHYNFQWWQLQELERIFQQNHFIRAEERRHLARWIGVSEARVMTWFKKRREHFRRGQSQLGMNDDAPVGSHSTFL"
     misc_feature    516..692
                     /gene="Rhox4b"
                     /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(516..530,534..536,585..587,603..605,642..644,
                     648..653,660..665,669..677,681..686)
                     /gene="Rhox4b"
                     /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(522..524,531..533,651..653,660..665,672..674)
                     /gene="Rhox4b"
                     /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            199..604
                     /gene="Rhox4b"
                     /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a"
                     /inference="alignment:Splign:2.1.0"
     exon            605..650
                     /gene="Rhox4b"
                     /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a"
                     /inference="alignment:Splign:2.1.0"
     exon            651..886
                     /gene="Rhox4b"
                     /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ggctttcagctttcggctttcggctttcagctttcggctgtcggctgtcggctttcagctttcggttttcacaacctcaggaactccgactcagaatctgctggggaaagctgcagggaagcactcaggacatggagcatcaaaacaccaactacctacttcatgagggacttggcaaggacaaggaaaagttgaatggtgggaagacacagacagtcttaccactggatggagagggaagaaatgagggagagagtgtactgggccagtccggagccgcagcagtggaatgggacaaagcagaagaattaagtggagaaggtgggcctgctgctggtgatgcagacctcatggataacagcaaccaagaggaccaggacaccagtggcagtgcccaggaggaggagaagctgccagaggagccagttctcagggatgctgtggtcatagacaaagtgcagcctattccagtgctggtatctggtgtgcggcctaagtcagtgtgggtacagcagcgtagcttacactacaatttccaatggtggcagctgcaggagctggagcgcattttccagcagaatcacttcatccgtgcagaggaaagaagacatctggcaagatggataggtgtgagtgaagccagagttatgacatggtttaagaagaggagagagcacttcagaagaggacaaagtcagttaggaatgaatgatgatgcccctgtggggtcccactctacctttctctgaagatggcacaggaggcctggtgtaccacccttgaccaggagccacgtgcagacccctgctgccttccaccagcatgttattgcatctctattccctaagcatttgtatgtgaaataaatagattctcagtttctttg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]