LOCUS       NM_019537               1057 bp    mRNA    linear   ROD 05-AUG-2023
DEFINITION  Mus musculus proteasome (prosome, macropain) assembly chaperone 1
            (Psmg1), mRNA.
ACCESSION   NM_019537
VERSION     NM_019537.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1057)
  AUTHORS   Koscielny G, Yaikhom G, Iyer V, Meehan TF, Morgan H,
            Atienza-Herrero J, Blake A, Chen CK, Easty R, Di Fenza A, Fiegel T,
            Grifiths M, Horne A, Karp NA, Kurbatova N, Mason JC, Matthews P,
            Oakley DJ, Qazi A, Regnart J, Retha A, Santos LA, Sneddon DJ,
            Warren J, Westerberg H, Wilson RJ, Melvin DG, Smedley D, Brown SD,
            Flicek P, Skarnes WC, Mallon AM and Parkinson H.
  TITLE     The International Mouse Phenotyping Consortium Web Portal, a
            unified point of access for knockout mice and related phenotyping
            data
  JOURNAL   Nucleic Acids Res 42 (Database issue), D802-D809 (2014)
   PUBMED   24194600
REFERENCE   2  (bases 1 to 1057)
  AUTHORS   Sasaki K, Hamazaki J, Koike M, Hirano Y, Komatsu M, Uchiyama Y,
            Tanaka K and Murata S.
  TITLE     PAC1 gene knockout reveals an essential role of chaperone-mediated
            20S proteasome biogenesis and latent 20S proteasomes in cellular
            homeostasis
  JOURNAL   Mol Cell Biol 30 (15), 3864-3874 (2010)
   PUBMED   20498273
REFERENCE   3  (bases 1 to 1057)
  AUTHORS   Gitton Y, Dahmane N, Baik S, Ruiz i Altaba A, Neidhardt L, Scholze
            M, Herrmann BG, Kahlem P, Benkahla A, Schrinner S, Yildirimman R,
            Herwig R, Lehrach H and Yaspo ML.
  CONSRTM   HSA21 expression map initiative
  TITLE     A gene expression map of human chromosome 21 orthologues in the
            mouse
  JOURNAL   Nature 420 (6915), 586-590 (2002)
   PUBMED   12466855
REFERENCE   4  (bases 1 to 1057)
  AUTHORS   Reymond A, Marigo V, Yaylaoglu MB, Leoni A, Ucla C, Scamuffa N,
            Caccioppoli C, Dermitzakis ET, Lyle R, Banfi S, Eichele G,
            Antonarakis SE and Ballabio A.
  TITLE     Human chromosome 21 gene expression atlas in the mouse
  JOURNAL   Nature 420 (6915), 582-586 (2002)
   PUBMED   12466854
REFERENCE   5  (bases 1 to 1057)
  AUTHORS   Pletcher MT, Wiltshire T, Cabin DE, Villanueva M and Reeves RH.
  TITLE     Use of comparative physical and sequence mapping to annotate mouse
            chromosome 16 and human chromosome 21
  JOURNAL   Genomics 74 (1), 45-54 (2001)
   PUBMED   11374901
REFERENCE   6  (bases 1 to 1057)
  AUTHORS   Vidal-Taboada JM, Lu A, Pique M, Pons G, Gil J and Oliva R.
  TITLE     Down syndrome critical region gene 2: expression during mouse
            development and in human cell lines indicates a function related to
            cell proliferation
  JOURNAL   Biochem Biophys Res Commun 272 (1), 156-163 (2000)
   PUBMED   10872820
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BG086724.2 and BC032965.1.
            
            On Jan 24, 2017 this sequence version replaced NM_019537.2.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC060285.1, AJ238270.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164131, SAMN01164135
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-64                BG086724.2         1-64
            65-1057             BC032965.1         1-993
FEATURES             Location/Qualifiers
     source          1..1057
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="16"
                     /map="16 56.76 cM"
     gene            1..1057
                     /gene="Psmg1"
                     /gene_synonym="Dscr2"
                     /note="proteasome (prosome, macropain) assembly chaperone
                     1"
                     /db_xref="GeneID:56088"
                     /db_xref="MGI:MGI:1860263"
     exon            1..207
                     /gene="Psmg1"
                     /gene_synonym="Dscr2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    62..64
                     /gene="Psmg1"
                     /gene_synonym="Dscr2"
                     /note="upstream in-frame stop codon"
     CDS             71..940
                     /gene="Psmg1"
                     /gene_synonym="Dscr2"
                     /note="down syndrome critical region protein 2 homolog;
                     Down syndrome critical region homolog 2"
                     /codon_start=1
                     /product="proteasome assembly chaperone 1"
                     /protein_id="NP_062410.1"
                     /db_xref="CCDS:CCDS28352.1"
                     /db_xref="GeneID:56088"
                     /db_xref="MGI:MGI:1860263"
                     /translation="

MAATFFGEVVKAPCRAGTEEEEEEEEQSRRDTPEDREVRRQLARKREVRLLRRQTETSLEAVLLETHPCSKFIIAVGSNATAFLSAFVMNSGVWEEVGCAKLWNEWCRTTDTVRLSPTDVFCVFYQLKSDPSVFLCQCSCYIAEDQQFQWLEKVFGFQPRKSMQVTVLTCRHITDYKTPESTCSLSSPFLRALKTQTFKDALCCPLLEQPNIVHDLSAAVLSYCQVWKIPAVLYLCYTDVMKLDRVTVEAFKPLLSSRSLKCLVKNIPESTEILKKLMTTNEIQSNIYT"

     misc_feature    71..184
                     /gene="Psmg1"
                     /gene_synonym="Dscr2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JK23.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    74..937
                     /gene="Psmg1"
                     /gene_synonym="Dscr2"
                     /note="Proteasome assembly chaperone 4; Region: PAC1;
                     pfam16094"
                     /db_xref="CDD:435132"
     misc_feature    74..76
                     /gene="Psmg1"
                     /gene_synonym="Dscr2"
                     /note="N-acetylalanine.
                     /evidence=ECO:0000250|UniProtKB:O95456; propagated from
                     UniProtKB/Swiss-Prot (Q9JK23.1); acetylation site"
     misc_feature    122..124
                     /gene="Psmg1"
                     /gene_synonym="Dscr2"
                     /note="Phosphothreonine.
                     /evidence=ECO:0000250|UniProtKB:O95456; propagated from
                     UniProtKB/Swiss-Prot (Q9JK23.1); phosphorylation site"
     misc_feature    233..235
                     /gene="Psmg1"
                     /gene_synonym="Dscr2"
                     /note="Phosphothreonine.
                     /evidence=ECO:0000250|UniProtKB:O95456; propagated from
                     UniProtKB/Swiss-Prot (Q9JK23.1); phosphorylation site"
     misc_feature    611..613
                     /gene="Psmg1"
                     /gene_synonym="Dscr2"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:O95456; propagated from
                     UniProtKB/Swiss-Prot (Q9JK23.1); phosphorylation site"
     misc_feature    863..865
                     /gene="Psmg1"
                     /gene_synonym="Dscr2"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:O95456; propagated from
                     UniProtKB/Swiss-Prot (Q9JK23.1); acetylation site"
     exon            208..314
                     /gene="Psmg1"
                     /gene_synonym="Dscr2"
                     /inference="alignment:Splign:2.1.0"
     exon            315..466
                     /gene="Psmg1"
                     /gene_synonym="Dscr2"
                     /inference="alignment:Splign:2.1.0"
     exon            467..529
                     /gene="Psmg1"
                     /gene_synonym="Dscr2"
                     /inference="alignment:Splign:2.1.0"
     exon            530..728
                     /gene="Psmg1"
                     /gene_synonym="Dscr2"
                     /inference="alignment:Splign:2.1.0"
     exon            729..865
                     /gene="Psmg1"
                     /gene_synonym="Dscr2"
                     /inference="alignment:Splign:2.1.0"
     exon            866..1044
                     /gene="Psmg1"
                     /gene_synonym="Dscr2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

cgtggcttggagggggcgtgactgcgggccggcgcgcatgcgctgtctggccgcgcggagctgagggaccatggctgccacgttctttggcgaggtggtgaaggcgccgtgcagagctgggactgaggaggaagaagaggaggaggagcagagcaggcgggacacgccggaggaccgggaggtccggcggcagctggcgcggaagagggaggttcggcttctccgaagacagacagaaacatctctggaggctgtgctcctagagacacacccttgctccaagtttataattgcagtaggaagcaacgcaacagcattcctgtcagcgtttgttatgaactcgggagtctgggaagaagtcggttgtgctaagctctggaatgaatggtgcagaactacagacactgtccgtctgtcccctacagatgttttctgtgtgttttatcaactgaaatcagatccctcggtttttctatgtcagtgtagctgctacattgctgaggatcagcagttccagtggttggagaaggttttcggcttccaacccagaaagagcatgcaggtaaccgttctcacatgccggcacatcacagactacaagacccccgagtctacctgcagcctttcctctcctttcctgagagccctaaaaactcagacattcaaagatgccctctgctgcccactgctggaacagccgaacattgtgcatgacctgtctgcagcagttctgagctactgtcaagtatggaaaatccctgcggttctgtatctgtgctacactgatgtgatgaagttggaccgtgtcacggttgaagcttttaaaccgttactttcttccaggagcttgaaatgcttggtgaagaacattcctgaaagcacagaaattctgaagaagttgatgaccacaaatgagattcagagcaacatttacacatgaccccaggtggccaggacctgcctgttccagggggcagtcactgatgttttgtattttattctggcttgggatgttttgagagtaataaaaattttaaaaattaaaaaaaaaaaaaaa

//