LOCUS       NM_011817               1081 bp    mRNA    linear   ROD 06-AUG-2023
DEFINITION  Mus musculus growth arrest and DNA-damage-inducible 45 gamma
            (Gadd45g), mRNA.
ACCESSION   NM_011817
VERSION     NM_011817.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1081)
  AUTHORS   Warr N, Siggers P, May J, Chalon N, Pope M, Wells S, Chaboissier MC
            and Greenfield A.
  TITLE     Gadd45g is required for timely Sry expression independently of
            RSPO1 activity
  JOURNAL   Reproduction 163 (6), 333-340 (2022)
   PUBMED   35315790
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1081)
  AUTHORS   Sun Y, Wang L, Zhu T, Wu B, Wang G, Luo Z, Li C, Wei W and Liu Z.
  TITLE     Single-cell transcriptomic landscapes of the otic neuronal lineage
            at multiple early embryonic ages
  JOURNAL   Cell Rep 38 (12), 110542 (2022)
   PUBMED   35320729
REFERENCE   3  (bases 1 to 1081)
  AUTHORS   Zhang L, Li Q, Wang H, Wu Y, Ye X, Gong Z, Li Q and Xuan A.
  TITLE     Gadd45g, A Novel Antidepressant Target, Mediates Metformin-Induced
            Neuronal Differentiation of Neural Stem Cells Via DNA Demethylation
  JOURNAL   Stem Cells 40 (1), 59-73 (2022)
   PUBMED   35511865
  REMARK    GeneRIF: Gadd45g, A Novel Antidepressant Target, Mediates
            Metformin-Induced Neuronal Differentiation of Neural Stem Cells Via
            DNA Demethylation.
REFERENCE   4  (bases 1 to 1081)
  AUTHORS   Lee DR, Rhodes C, Mitra A, Zhang Y, Maric D, Dale RK and Petros TJ.
  TITLE     Transcriptional heterogeneity of ventricular zone cells in the
            ganglionic eminences of the mouse forebrain
  JOURNAL   Elife 11, e71864 (2022)
   PUBMED   35175194
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1081)
  AUTHORS   Ulmke PA, Sakib MS, Ditte P, Sokpor G, Kerimoglu C, Pham L, Xie Y,
            Mao X, Rosenbusch J, Teichmann U, Nguyen HP, Fischer A, Eichele G,
            Staiger JF and Tuoc T.
  TITLE     Molecular Profiling Reveals Involvement of ESCO2 in Intermediate
            Progenitor Cell Maintenance in the Developing Mouse Cortex
  JOURNAL   Stem Cell Reports 16 (4), 968-984 (2021)
   PUBMED   33798452
REFERENCE   6  (bases 1 to 1081)
  AUTHORS   Lu B, Yu H, Chow C, Li B, Zheng W, Davis RJ and Flavell RA.
  TITLE     GADD45gamma mediates the activation of the p38 and JNK MAP kinase
            pathways and cytokine production in effector TH1 cells
  JOURNAL   Immunity 14 (5), 583-590 (2001)
   PUBMED   11371360
REFERENCE   7  (bases 1 to 1081)
  AUTHORS   Hoffmeyer A, Piekorz R, Moriggl R and Ihle JN.
  TITLE     Gadd45gamma is dispensable for normal mouse development and T-cell
            proliferation
  JOURNAL   Mol Cell Biol 21 (9), 3137-3143 (2001)
   PUBMED   11287618
REFERENCE   8  (bases 1 to 1081)
  AUTHORS   Azam N, Vairapandi M, Zhang W, Hoffman B and Liebermann DA.
  TITLE     Interaction of CR6 (GADD45gamma) with proliferating cell nuclear
            antigen impedes negative growth control
  JOURNAL   J Biol Chem 276 (4), 2766-2774 (2001)
   PUBMED   11022036
REFERENCE   9  (bases 1 to 1081)
  AUTHORS   Zhang W, Bae I, Krishnaraju K, Azam N, Fan W, Smith K, Hoffman B
            and Liebermann DA.
  TITLE     CR6: A third member in the MyD118 and Gadd45 gene family which
            functions in negative growth control
  JOURNAL   Oncogene 18 (35), 4899-4907 (1999)
   PUBMED   10490824
REFERENCE   10 (bases 1 to 1081)
  AUTHORS   Nakayama K, Hara T, Hibi M, Hirano T and Miyajima A.
  TITLE     A novel oncostatin M-inducible gene OIG37 forms a gene family with
            MyD118 and GADD45 and negatively regulates cell growth
  JOURNAL   J Biol Chem 274 (35), 24766-24772 (1999)
   PUBMED   10455148
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC126247.3.
            
            On Jul 22, 2009 this sequence version replaced NM_011817.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC001989.1, AF055638.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849375
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-158               AC126247.3         102793-102950
            159-260             AC126247.3         103470-103571
            261-474             AC126247.3         103674-103887
            475-1081            AC126247.3         103987-104593
FEATURES             Location/Qualifiers
     source          1..1081
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="13"
                     /map="13 26.36 cM"
     gene            1..1081
                     /gene="Gadd45g"
                     /gene_synonym="CR6; DDIT2; OIG37"
                     /note="growth arrest and DNA-damage-inducible 45 gamma"
                     /db_xref="GeneID:23882"
                     /db_xref="MGI:MGI:1346325"
     exon            1..158
                     /gene="Gadd45g"
                     /gene_synonym="CR6; DDIT2; OIG37"
                     /inference="alignment:Splign:2.1.0"
     CDS             106..585
                     /gene="Gadd45g"
                     /gene_synonym="CR6; DDIT2; OIG37"
                     /note="cytokine-responsive protein CR6; growth arrest and
                     DNA-damage-inducible, gamma"
                     /codon_start=1
                     /product="growth arrest and DNA damage-inducible protein
                     GADD45 gamma"
                     /protein_id="NP_035947.2"
                     /db_xref="CCDS:CCDS26515.1"
                     /db_xref="GeneID:23882"
                     /db_xref="MGI:MGI:1346325"
                     /translation="

MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGADEEGGAPGDLHCILISNPNEDTWKDPALEKLSLFCEESRSFNDWVPSITLPE"

     misc_feature    175..>423
                     /gene="Gadd45g"
                     /gene_synonym="CR6; DDIT2; OIG37"
                     /note="Ribosomal protein L7Ae/L30e/S12e/Gadd45 family;
                     Region: Ribosomal_L7Ae; pfam01248"
                     /db_xref="CDD:426153"
     misc_feature    232..363
                     /gene="Gadd45g"
                     /gene_synonym="CR6; DDIT2; OIG37"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z111.1);
                     Region: Homodimerization. /evidence=ECO:0000250"
     exon            159..260
                     /gene="Gadd45g"
                     /gene_synonym="CR6; DDIT2; OIG37"
                     /inference="alignment:Splign:2.1.0"
     exon            261..474
                     /gene="Gadd45g"
                     /gene_synonym="CR6; DDIT2; OIG37"
                     /inference="alignment:Splign:2.1.0"
     exon            475..1081
                     /gene="Gadd45g"
                     /gene_synonym="CR6; DDIT2; OIG37"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ggcgcactcgctggtggtgggcgcgcatcggactctgggaatctttacctgcgctcgggttccctccgcactcttttggataacttgctgttcgtggatcgcacaatgactctggaagaagtccgtggccaggatacagttccggaaagcacagccaggatgcagggcgccgggaaagcactgcacgaacttctgctgtcggcgcagcgccagggctgtctgaccgctggcgtctacgagtccgccaaagtcctgaatgtggaccctgacaatgtgaccttttgcgtgctggctgccgatgaagaagatgagggcgacatagcgctgcagatccatttcacgttgattcaggcgttctgctgtgagaacgacattgatatcgtgcgcgtgggagacgtgcagaggctggcggcgatcgtgggcgccgacgaagaggggggcgcgccgggagacctgcattgcatcctcatttcgaatcctaatgaggacacatggaaggaccctgccttggagaagctcagtttgttctgcgaggagagccgcagcttcaacgactgggtgcccagcatcacccttcccgagtgacagcctggcagggaccttggtctgatcgacttggtgacactctagcgcgctgctggctctggagtggccctccgagggcgctcgagtgcgcgtggagactggcaggcgatgttgcctggagagcgaggagcgcggcctcccaagaagggggtctggcggcagcggggacaccttgttccgagcccaggactctgccagtgtccggagaggctgctagcacaggaaggcctaggcgaggacgttggccccagggccgggaagaaccgaccagcgaggcaggtgtgactcagcaagcagccttccagtgaaaggaggggaaagaaaggcaggcgaccgcctggacttggtacagcggcaggagcggccactgcaggagcgagctggacttagccgactgcactgctctttcaaaaaacggatcccgggcaatgctttcattttctaaaggacgctatcgtggaagctttgaatatcacaataaacttattgaaacaaa

//