2025-07-01 05:22:43, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_011292 737 bp mRNA linear ROD 03-APR-2024 DEFINITION Mus musculus ribosomal protein L9 (Rpl9), mRNA. ACCESSION NM_011292 VERSION NM_011292.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 737) AUTHORS Li,H., Huo,Y., He,X., Yao,L., Zhang,H., Cui,Y., Xiao,H., Xie,W., Zhang,D., Wang,Y., Zhang,S., Tu,H., Cheng,Y., Guo,Y., Cao,X., Zhu,Y., Jiang,T., Guo,X., Qin,Y. and Sha,J. TITLE A male germ-cell-specific ribosome controls male fertility JOURNAL Nature 612 (7941), 725-731 (2022) PUBMED 36517592 REFERENCE 2 (bases 1 to 737) AUTHORS Watanabe,M., Toyomura,T., Wake,H., Nishinaka,T., Hatipoglu,O.F., Takahashi,H., Nishibori,M. and Mori,S. TITLE Identification of ribosomal protein L9 as a novel regulator of proinflammatory damage-associated molecular pattern molecules JOURNAL Mol Biol Rep 49 (4), 2831-2838 (2022) PUBMED 35059969 REMARK GeneRIF: Identification of ribosomal protein L9 as a novel regulator of proinflammatory damage-associated molecular pattern molecules. REFERENCE 3 (bases 1 to 737) AUTHORS Khatter,H., Myasnikov,A.G., Natchiar,S.K. and Klaholz,B.P. TITLE Structure of the human 80S ribosome JOURNAL Nature 520 (7549), 640-645 (2015) PUBMED 25901680 REFERENCE 4 (bases 1 to 737) AUTHORS Beyer,A.R., Bann,D.V., Rice,B., Pultz,I.S., Kane,M., Goff,S.P., Golovkina,T.V. and Parent,L.J. TITLE Nucleolar trafficking of the mouse mammary tumor virus gag protein induced by interaction with ribosomal protein L9 JOURNAL J Virol 87 (2), 1069-1082 (2013) PUBMED 23135726 REMARK GeneRIF: These data support the hypothesis that efficient mouse mammary tumor virus particle assembly is dependent upon the interaction of Gag and L9 in the nucleoli of infected cells. REFERENCE 5 (bases 1 to 737) AUTHORS Kondrashov,N., Pusic,A., Stumpf,C.R., Shimizu,K., Hsieh,A.C., Ishijima,J., Shiroishi,T. and Barna,M. TITLE Ribosome-mediated specificity in Hox mRNA translation and vertebrate tissue patterning JOURNAL Cell 145 (3), 383-397 (2011) PUBMED 21529712 REFERENCE 6 (bases 1 to 737) AUTHORS Trinidad,J.C., Specht,C.G., Thalhammer,A., Schoepfer,R. and Burlingame,A.L. TITLE Comprehensive identification of phosphorylation sites in postsynaptic density preparations JOURNAL Mol Cell Proteomics 5 (5), 914-922 (2006) PUBMED 16452087 REFERENCE 7 (bases 1 to 737) AUTHORS Ko,M.S., Threat,T.A., Wang,X., Horton,J.H., Cui,Y., Wang,X., Pryor,E., Paris,J., Wells-Smith,J., Kitchen,J.R., Rowe,L.B., Eppig,J., Satoh,T., Brant,L., Fujiwara,H., Yotsumoto,S. and Nakashima,H. TITLE Genome-wide mapping of unselected transcripts from extraembryonic tissue of 7.5-day mouse embryos reveals enrichment in the t-complex and under-representation on the X chromosome JOURNAL Hum Mol Genet 7 (12), 1967-1978 (1998) PUBMED 9811942 REFERENCE 8 (bases 1 to 737) AUTHORS Monach,P.A., Meredith,S.C., Siegel,C.T. and Schreiber,H. TITLE A unique tumor antigen produced by a single amino acid substitution JOURNAL Immunity 2 (1), 45-59 (1995) PUBMED 7600302 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BY072215.1 and BC089319.1. On Jul 24, 2008 this sequence version replaced NM_011292.1. ##Evidence-Data-START## Transcript exon combination :: BC086937.1, CF949991.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMN00849374, SAMN00849375 [ECO:0006172] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-51 BY072215.1 2-52 52-737 BC089319.1 1-686 FEATURES Location/Qualifiers source 1..737 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="5" /map="5 33.66 cM" gene 1..737 /gene="Rpl9" /note="ribosomal protein L9" /db_xref="GeneID:20005" /db_xref="MGI:MGI:1298373" exon 1..56 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 57..103 /gene="Rpl9" /inference="alignment:Splign:2.1.0" CDS 58..636 /gene="Rpl9" /note="60S ribosomal protein L9" /codon_start=1 /product="large ribosomal subunit protein uL6" /protein_id="NP_035422.1" /db_xref="CCDS:CCDS39097.1" /db_xref="GeneID:20005" /db_xref="MGI:MGI:1298373" /translation="
MKTILSNQTVDIPENVEITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRTGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE"
misc_feature 58..630 /gene="Rpl9" /note="60S ribosomal protein L6; Provisional; Region: PTZ00027" /db_xref="CDD:240234" misc_feature 418..420 /gene="Rpl9" /note="N6-acetyllysine. /evidence=ECO:0000250|UniProtKB:P32969; propagated from UniProtKB/Swiss-Prot (P51410.2); acetylation site" exon 104..219 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 220..315 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 316..448 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 449..529 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 530..647 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 648..725 /gene="Rpl9" /inference="alignment:Splign:2.1.0" ORIGIN
ggattacaagaacgtgatgacgaaagacgttctctctttgccccatctactgcgaggatgaagaccattctcagcaatcagactgtggacattccagagaatgtcgaaatcactctgaaggggcgcacagtcattgtgaagggccccagggggactctgcggagggacttcaatcacatcaacgtggagctgagtcttcttgggaagaagaagaaaaggctccgggttgacaaatggtggggtaacagaaaggaactggccaccgtcaggaccatctgcagtcatgttcagaacatgatcaagggtgtcacgctgggcttccgatacaagatgcggtctgtgtacgctcacttccccatcaacgtcgtcatccaggagaatggctctttggttgaaatccgaaatttcttgggtgaaaaatacatccgcagggttcggatgaggacaggtgtggcttgttctgtctctcaagcccagaaggatgagttaatccttgaaggaaatgacattgaacttgtttcaaattcagctgccctgattcagcaagccacaacagttaaaaacaaggatatcaggaagtttttggacggcatctatgtgtctgagaagggaactgtgcagcaggctgacgagtgaggaggcctcagttcctggccccagaaacgagatcctgaccacatgaacaatttgggctcttttgggagaataaaagacttatatattgaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]