LOCUS       NM_011292                737 bp    mRNA    linear   ROD 27-APR-2025
DEFINITION  Mus musculus ribosomal protein L9 (Rpl9), mRNA.
ACCESSION   NM_011292
VERSION     NM_011292.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 737)
  AUTHORS   Li,H., Huo,Y., He,X., Yao,L., Zhang,H., Cui,Y., Xiao,H., Xie,W.,
            Zhang,D., Wang,Y., Zhang,S., Tu,H., Cheng,Y., Guo,Y., Cao,X.,
            Zhu,Y., Jiang,T., Guo,X., Qin,Y. and Sha,J.
  TITLE     A male germ-cell-specific ribosome controls male fertility
  JOURNAL   Nature 612 (7941), 725-731 (2022)
   PUBMED   36517592
REFERENCE   2  (bases 1 to 737)
  AUTHORS   Watanabe,M., Toyomura,T., Wake,H., Nishinaka,T., Hatipoglu,O.F.,
            Takahashi,H., Nishibori,M. and Mori,S.
  TITLE     Identification of ribosomal protein L9 as a novel regulator of
            proinflammatory damage-associated molecular pattern molecules
  JOURNAL   Mol Biol Rep 49 (4), 2831-2838 (2022)
   PUBMED   35059969
  REMARK    GeneRIF: Identification of ribosomal protein L9 as a novel
            regulator of proinflammatory damage-associated molecular pattern
            molecules.
REFERENCE   3  (bases 1 to 737)
  AUTHORS   Khatter,H., Myasnikov,A.G., Natchiar,S.K. and Klaholz,B.P.
  TITLE     Structure of the human 80S ribosome
  JOURNAL   Nature 520 (7549), 640-645 (2015)
   PUBMED   25901680
REFERENCE   4  (bases 1 to 737)
  AUTHORS   Beyer,A.R., Bann,D.V., Rice,B., Pultz,I.S., Kane,M., Goff,S.P.,
            Golovkina,T.V. and Parent,L.J.
  TITLE     Nucleolar trafficking of the mouse mammary tumor virus gag protein
            induced by interaction with ribosomal protein L9
  JOURNAL   J Virol 87 (2), 1069-1082 (2013)
   PUBMED   23135726
  REMARK    GeneRIF: These data support the hypothesis that efficient mouse
            mammary tumor virus particle assembly is dependent upon the
            interaction of Gag and L9 in the nucleoli of infected cells.
REFERENCE   5  (bases 1 to 737)
  AUTHORS   Kondrashov,N., Pusic,A., Stumpf,C.R., Shimizu,K., Hsieh,A.C.,
            Ishijima,J., Shiroishi,T. and Barna,M.
  TITLE     Ribosome-mediated specificity in Hox mRNA translation and
            vertebrate tissue patterning
  JOURNAL   Cell 145 (3), 383-397 (2011)
   PUBMED   21529712
REFERENCE   6  (bases 1 to 737)
  AUTHORS   Trinidad,J.C., Specht,C.G., Thalhammer,A., Schoepfer,R. and
            Burlingame,A.L.
  TITLE     Comprehensive identification of phosphorylation sites in
            postsynaptic density preparations
  JOURNAL   Mol Cell Proteomics 5 (5), 914-922 (2006)
   PUBMED   16452087
REFERENCE   7  (bases 1 to 737)
  AUTHORS   Ko,M.S., Threat,T.A., Wang,X., Horton,J.H., Cui,Y., Wang,X.,
            Pryor,E., Paris,J., Wells-Smith,J., Kitchen,J.R., Rowe,L.B.,
            Eppig,J., Satoh,T., Brant,L., Fujiwara,H., Yotsumoto,S. and
            Nakashima,H.
  TITLE     Genome-wide mapping of unselected transcripts from extraembryonic
            tissue of 7.5-day mouse embryos reveals enrichment in the t-complex
            and under-representation on the X chromosome
  JOURNAL   Hum Mol Genet 7 (12), 1967-1978 (1998)
   PUBMED   9811942
REFERENCE   8  (bases 1 to 737)
  AUTHORS   Monach,P.A., Meredith,S.C., Siegel,C.T. and Schreiber,H.
  TITLE     A unique tumor antigen produced by a single amino acid substitution
  JOURNAL   Immunity 2 (1), 45-59 (1995)
   PUBMED   7600302
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BY072215.1 and BC089319.1.
            
            On Jul 24, 2008 this sequence version replaced NM_011292.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC086937.1, CF949991.1 [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMN00849374,
                                           SAMN00849375 [ECO:0006172]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-51                BY072215.1         2-52
            52-737              BC089319.1         1-686
FEATURES             Location/Qualifiers
     source          1..737
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="5"
                     /map="5 33.66 cM"
     gene            1..737
                     /gene="Rpl9"
                     /note="ribosomal protein L9"
                     /db_xref="GeneID:20005"
                     /db_xref="MGI:MGI:1298373"
     exon            1..56
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            57..103
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     CDS             58..636
                     /gene="Rpl9"
                     /note="60S ribosomal protein L9"
                     /codon_start=1
                     /product="large ribosomal subunit protein uL6"
                     /protein_id="NP_035422.1"
                     /db_xref="CCDS:CCDS39097.1"
                     /db_xref="GeneID:20005"
                     /db_xref="MGI:MGI:1298373"
                     /translation="

MKTILSNQTVDIPENVEITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRTGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE"

     misc_feature    58..630
                     /gene="Rpl9"
                     /note="60S ribosomal protein L6; Provisional; Region:
                     PTZ00027"
                     /db_xref="CDD:240234"
     misc_feature    418..420
                     /gene="Rpl9"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P32969; propagated from
                     UniProtKB/Swiss-Prot (P51410.2); acetylation site"
     exon            104..219
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            220..315
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            316..448
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            449..529
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            530..647
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            648..725
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ggattacaagaacgtgatgacgaaagacgttctctctttgccccatctactgcgaggatgaagaccattctcagcaatcagactgtggacattccagagaatgtcgaaatcactctgaaggggcgcacagtcattgtgaagggccccagggggactctgcggagggacttcaatcacatcaacgtggagctgagtcttcttgggaagaagaagaaaaggctccgggttgacaaatggtggggtaacagaaaggaactggccaccgtcaggaccatctgcagtcatgttcagaacatgatcaagggtgtcacgctgggcttccgatacaagatgcggtctgtgtacgctcacttccccatcaacgtcgtcatccaggagaatggctctttggttgaaatccgaaatttcttgggtgaaaaatacatccgcagggttcggatgaggacaggtgtggcttgttctgtctctcaagcccagaaggatgagttaatccttgaaggaaatgacattgaacttgtttcaaattcagctgccctgattcagcaagccacaacagttaaaaacaaggatatcaggaagtttttggacggcatctatgtgtctgagaagggaactgtgcagcaggctgacgagtgaggaggcctcagttcctggccccagaaacgagatcctgaccacatgaacaatttgggctcttttgggagaataaaagacttatatattgaaaaaaaaaaaaa

//