2024-09-28 11:16:30, GGRNA.v2 : RefSeq release 225 (Jul, 2024)
LOCUS NM_010646 870 bp mRNA linear ROD 16-FEB-2022 DEFINITION Mus musculus killer cell lectin-like receptor subfamily A, member 12 (Klra12), mRNA. ACCESSION NM_010646 XM_003945728 VERSION NM_010646.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 870) AUTHORS Schenkel AR, Kingry LC and Slayden RA. TITLE The ly49 gene family. A brief guide to the nomenclature, genetics, and role in intracellular infection JOURNAL Front Immunol 4, 90 (2013) PUBMED 23596445 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 870) AUTHORS Back J, Malchiodi EL, Cho S, Scarpellino L, Schneider P, Kerzic MC, Mariuzza RA and Held W. TITLE Distinct conformations of Ly49 natural killer cell receptors mediate MHC class I recognition in trans and cis JOURNAL Immunity 31 (4), 598-608 (2009) PUBMED 19818651 REMARK GeneRIF: The distinct conformations (backfolded and extended) define the structural basis for cis-trans binding by Ly49 receptors and explain the divergent functional consequences of cis versus trans interactions. REFERENCE 3 (bases 1 to 870) AUTHORS Makrigiannis AP, Patel D, Goulet ML, Dewar K and Anderson SK. TITLE Direct sequence comparison of two divergent class I MHC natural killer cell receptor haplotypes JOURNAL Genes Immun 6 (2), 71-83 (2005) PUBMED 15674375 REFERENCE 4 (bases 1 to 870) AUTHORS Proteau MF, Rousselle E and Makrigiannis AP. TITLE Mapping of the BALB/c Ly49 cluster defines a minimal natural killer cell receptor gene repertoire JOURNAL Genomics 84 (4), 669-677 (2004) PUBMED 15475244 REFERENCE 5 (bases 1 to 870) AUTHORS Makrigiannis AP, Pau AT, Schwartzberg PL, McVicar DW, Beck TW and Anderson SK. TITLE A BAC contig map of the Ly49 gene cluster in 129 mice reveals extensive differences in gene content relative to C57BL/6 mice JOURNAL Genomics 79 (3), 437-444 (2002) PUBMED 11863373 REFERENCE 6 (bases 1 to 870) AUTHORS Makrigiannis AP, Pau AT, Saleh A, Winkler-Pickett R, Ortaldo JR and Anderson SK. TITLE Class I MHC-binding characteristics of the 129/J Ly49 repertoire JOURNAL J Immunol 166 (8), 5034-5043 (2001) PUBMED 11290784 REFERENCE 7 (bases 1 to 870) AUTHORS Silver ET, Gong D, Hazes B and Kane KP. TITLE Ly-49W, an activating receptor of nonobese diabetic mice with close homology to the inhibitory receptor Ly-49G, recognizes H-2D(k) and H-2D(d) JOURNAL J Immunol 166 (4), 2333-2341 (2001) PUBMED 11160290 REFERENCE 8 (bases 1 to 870) AUTHORS Makrigiannis AP, Etzler J, Winkler-Pickett R, Mason A, Ortaldo JR and Anderson SK. TITLE Identification of the Ly49L protein: evidence for activating counterparts to inhibitory Ly49 proteins JOURNAL J Leukoc Biol 68 (5), 765-771 (2000) PUBMED 11073118 REFERENCE 9 (bases 1 to 870) AUTHORS Depatie C, Lee SH, Stafford A, Avner P, Belouchi A, Gros P and Vidal SM. TITLE Sequence-ready BAC contig, physical, and transcriptional map of a 2-Mb region overlapping the mouse chromosome 6 host-resistance locus Cmv1 JOURNAL Genomics 66 (2), 161-174 (2000) PUBMED 10860661 REFERENCE 10 (bases 1 to 870) AUTHORS McQueen KL, Freeman JD, Takei F and Mager DL. TITLE Localization of five new Ly49 genes, including three closely related to Ly49c JOURNAL Immunogenetics 48 (3), 174-183 (1998) PUBMED 9683662 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AF307948.1. On Oct 10, 2012 this sequence version replaced XM_003945728.1. ##Evidence-Data-START## Transcript exon combination :: AF307948.1 [ECO:0000332] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..870 /organism="Mus musculus" /mol_type="mRNA" /strain="BALB/c" /db_xref="taxon:10090" /chromosome="6" /map="6" gene 1..870 /gene="Klra12" /gene_synonym="Ly49L; Ly49l1; Ly49l2; Ly49l3; Ly49l4; Ly49p/d" /note="killer cell lectin-like receptor subfamily A, member 12" /db_xref="GeneID:16630" /db_xref="MGI:MGI:1321091" CDS 58..855 /gene="Klra12" /gene_synonym="Ly49L; Ly49l1; Ly49l2; Ly49l3; Ly49l4; Ly49p/d" /note="novel killer cell lectin-like receptor, subfamily A protein" /codon_start=1 /product="killer cell lectin-like receptor subfamily A, member 12" /protein_id="NP_034776.1" /db_xref="GeneID:16630" /db_xref="MGI:MGI:1321091" /translation="
MSEQEVTFSAVRFHKSSGLQNRVRLEETGKPQKAGLRVPWQLIVIALGILISLRLVIVSVLVTNIFQNSQQNHELQETLNCHDKCSTTTQSDINLKDELLSSTSIECRPGNDLLESLHKEQNRWYSETKTFSDSSQHTGRGFEKYWFCYGIKCYYFVMDRKTWSGCKQTCQISSLSLLKIDNEDELKFLKLLVPSDSCWIGLSYDNKKKDWAWINNGPSKLALNTMKYNIRDGGCMLLSKTRLDNDNCDKSFICICGKRLDKFPH"
misc_feature 169..525 /gene="Klra12" /gene_synonym="Ly49L; Ly49l1; Ly49l2; Ly49l3; Ly49l4; Ly49p/d" /note="Ly49-like protein, N-terminal region; Region: Ly49; pfam08391" /db_xref="CDD:462461" misc_feature 484..831 /gene="Klra12" /gene_synonym="Ly49L; Ly49l1; Ly49l2; Ly49l3; Ly49l4; Ly49p/d" /note="C-type lectin-like domain (CTLD) of the type found in natural killer cell receptors (NKRs); Region: CLECT_NK_receptors_like; cd03593" /db_xref="CDD:153063" misc_feature order(646..648,727..729,781..783,787..792) /gene="Klra12" /gene_synonym="Ly49L; Ly49l1; Ly49l2; Ly49l3; Ly49l4; Ly49p/d" /note="ligand binding surface [chemical binding]; other site" /db_xref="CDD:153063" ORIGIN
cacagaaatcactcaaggacatattttaaaagagaacatactctacatcctcccaagatgagtgagcaggaggtcactttctcagctgtgagattccataagtcttcagggttgcagaaccgggtgaggcttgaggagacagggaagcctcaaaaagctggcctcagagttccctggcagctcattgtgatagctctcggaatcctcatttcccttcgactggtaattgtctcagtgcttgtgacaaacatttttcagaatagtcaacaaaatcatgaactgcaggaaactctaaactgccacgataagtgcagcaccaccactcaaagtgacatcaacttgaaggatgaactgctgagttctacatctatagagtgtaggccaggcaatgatcttctggaatccctccacaaggaacagaacagatggtacagtgaaaccaagactttttcagattcctcacagcacacaggcagaggttttgaaaaatattggttctgttatggtataaaatgttattatttcgtcatggacagaaaaacgtggagtggatgtaaacagacctgccagatttccagcttatcccttctgaagatagacaatgaggatgaactgaagttccttaagctcctggttccttcagacagttgctggattggattgtcatatgataataagaagaaagattgggcatggattaacaatggcccatctaaacttgccttgaacacaatgaaatataatataagagatggaggatgtatgttgttatctaaaacaagactagacaatgataactgtgataaatcattcatctgtatttgtgggaagagattggataaattccctcattgactctccagtgagtgt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]