2024-06-27 03:34:21, GGRNA.v2 : RefSeq release 224 (May, 2024)
LOCUS NM_009638 1416 bp mRNA linear ROD 05-FEB-2024 DEFINITION Mus musculus cysteine-rich secretory protein 1 (Crisp1), mRNA. ACCESSION NM_009638 VERSION NM_009638.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1416) AUTHORS Gaikwad,A.S., Nandagiri,A., Potter,D.L., Nosrati,R., O'Connor,A.E., Jadhav,S., Soria,J., Prabhakar,R. and O'Bryan,M.K. TITLE CRISPs Function to Boost Sperm Power Output and Motility JOURNAL Front Cell Dev Biol 9, 693258 (2021) PUBMED 34422816 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1416) AUTHORS Curci,L., Brukman,N.G., Weigel Munoz,M., Rojo,D., Carvajal,G., Sulzyk,V., Gonzalez,S.N., Rubinstein,M., Da Ros,V.G. and Cuasnicu,P.S. TITLE Functional redundancy and compensation: Deletion of multiple murine Crisp genes reveals their essential role for male fertility JOURNAL FASEB J 34 (12), 15718-15733 (2020) PUBMED 33037689 REFERENCE 3 (bases 1 to 1416) AUTHORS Weigel Munoz,M., Carvajal,G., Curci,L., Gonzalez,S.N. and Cuasnicu,P.S. TITLE Relevance of CRISP proteins for epididymal physiology, fertilization, and fertility JOURNAL Andrology 7 (5), 610-617 (2019) PUBMED 31218833 REMARK Review article REFERENCE 4 (bases 1 to 1416) AUTHORS Carvajal,G., Brukman,N.G., Weigel Munoz,M., Battistone,M.A., Guazzone,V.A., Ikawa,M., Haruhiko,M., Lustig,L., Breton,S. and Cuasnicu,P.S. TITLE Impaired male fertility and abnormal epididymal epithelium differentiation in mice lacking CRISP1 and CRISP4 JOURNAL Sci Rep 8 (1), 17531 (2018) PUBMED 30510210 REMARK GeneRIF: These observations reveal that CRISP proteins are relevant for epididymal epithelium differentiation and male fertility, contributing to a better understanding of the fine-tuning mechanisms underlying sperm maturation and immunotolerance in the epididymis with clear implications for human epididymal physiology and pathology. Publication Status: Online-Only REFERENCE 5 (bases 1 to 1416) AUTHORS Weigel Munoz,M., Battistone,M.A., Carvajal,G., Maldera,J.A., Curci,L., Torres,P., Lombardo,D., Pignataro,O.P., Da Ros,V.G. and Cuasnicu,P.S. TITLE Influence of the genetic background on the reproductive phenotype of mice lacking Cysteine-Rich Secretory Protein 1 (CRISP1) JOURNAL Biol Reprod 99 (2), 373-383 (2018) PUBMED 29481619 REMARK GeneRIF: phenotype of CRISP1 null males is modulated by the genetic context and reveal new roles for the protein in both the functional events and signaling pathways associated to sperm capacitation. REFERENCE 6 (bases 1 to 1416) AUTHORS Leem,E., Kim,H.J., Choi,M., Kim,S., Oh,Y.S., Lee,K.J., Choe,Y.S., Um,J.Y., Shin,W.H., Jeong,J.Y., Jin,B.K., Kim,D.W., McLean,C., Fisher,P.B., Kholodilov,N., Ahn,K.S., Lee,J.M., Jung,U.J., Lee,S.G. and Kim,S.R. TITLE Upregulation of neuronal astrocyte elevated gene-1 protects nigral dopaminergic neurons in vivo JOURNAL Cell Death Dis 9 (5), 449 (2018) PUBMED 29670079 REMARK GeneRIF: these results demonstrated that the sustained level of AEG-1 as an important anti-apoptotic factor in nigral dopaminergic (DA) neurons might potentiate the therapeutic effects of treatments, such as Rheb(S16H) administration, on the degeneration of the DA pathway that characterizes Parkinson's disease. Publication Status: Online-Only REFERENCE 7 (bases 1 to 1416) AUTHORS Eberspaecher,U., Roosterman,D., Kratzschmar,J., Haendler,B., Habenicht,U.F., Becker,A., Quensel,C., Petri,T., Schleuning,W.D. and Donner,P. TITLE Mouse androgen-dependent epididymal glycoprotein CRISP-1 (DE/AEG): isolation, biochemical characterization, and expression in recombinant form JOURNAL Mol Reprod Dev 42 (2), 157-172 (1995) PUBMED 8562061 REFERENCE 8 (bases 1 to 1416) AUTHORS Kasahara,M., Hayashi,M., Yoshida,M.C., Nadeau,J.H., Fujimoto,S. and Ishibashi,T. TITLE Mapping of acidic epididymal glycoprotein (Aeg) genes to mouse chromosome 17 JOURNAL Mamm Genome 6 (1), 52-54 (1995) PUBMED 7719028 REFERENCE 9 (bases 1 to 1416) AUTHORS Haendler,B., Kratzschmar,J., Theuring,F. and Schleuning,W.D. TITLE Transcripts for cysteine-rich secretory protein-1 (CRISP-1; DE/AEG) and the novel related CRISP-3 are expressed under androgen control in the mouse salivary gland JOURNAL Endocrinology 133 (1), 192-198 (1993) PUBMED 8319566 REFERENCE 10 (bases 1 to 1416) AUTHORS Mizuki,N. and Kasahara,M. TITLE Mouse submandibular glands express an androgen-regulated transcript encoding an acidic epididymal glycoprotein-like molecule JOURNAL Mol Cell Endocrinol 89 (1-2), 25-32 (1992) PUBMED 1301383 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK009449.1, M92849.1 and AC154497.2. On Oct 6, 2007 this sequence version replaced NM_009638.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC011150.1, AK009449.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849381, SAMN00849384 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-34 AK009449.1 2-35 35-1414 M92849.1 1-1380 1415-1416 AC154497.2 170045-170046 c FEATURES Location/Qualifiers source 1..1416 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="17" /map="17 19.47 cM" gene 1..1416 /gene="Crisp1" /gene_synonym="Aeg1; CRISP-1; SCP 1" /note="cysteine-rich secretory protein 1" /db_xref="GeneID:11571" /db_xref="MGI:MGI:102553" exon 1..53 /gene="Crisp1" /gene_synonym="Aeg1; CRISP-1; SCP 1" /inference="alignment:Splign:2.1.0" exon 54..127 /gene="Crisp1" /gene_synonym="Aeg1; CRISP-1; SCP 1" /inference="alignment:Splign:2.1.0" CDS 56..790 /gene="Crisp1" /gene_synonym="Aeg1; CRISP-1; SCP 1" /note="sperm-coating glycoprotein 1; acidic epididymal glycoprotein 1" /codon_start=1 /product="cysteine-rich secretory protein 1 precursor" /protein_id="NP_033768.3" /db_xref="CCDS:CCDS28784.1" /db_xref="GeneID:11571" /db_xref="MGI:MGI:102553" /translation="
MALMLVLFFLAAVLPPSLLQDSSQENRLEKLSTTKMSVQEEIVSKHNQLRRMVSPSGSDLLKMEWNYDAQVNAQQWADKCTFSHSPIELRTTNLRCGENLFMSSYLASWSSAIQGWYNEYKDLTYDVGPKQPDSVVGHYTQVVWNSTFQVACGVAECPKNPLRYYYVCHYCPVGNYQGRLYTPYTAGEPCASCPDHCEDGLCTNSCGHEDKYTNCKYLKKMLSCEHELLKKGCKATCLCEGKIH"
sig_peptide 56..112 /gene="Crisp1" /gene_synonym="Aeg1; CRISP-1; SCP 1" /inference="COORDINATES: ab initio prediction:SignalP:6.0" mat_peptide 113..787 /gene="Crisp1" /gene_synonym="Aeg1; CRISP-1; SCP 1" /product="Cysteine-rich secretory protein 1. /id=PRO_0000006262" /note="propagated from UniProtKB/Swiss-Prot (Q03401.1)" misc_feature 164..571 /gene="Crisp1" /gene_synonym="Aeg1; CRISP-1; SCP 1" /note="CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain of cysteine-rich secretory proteins; Region: CAP_CRISP; cd05383" /db_xref="CDD:349402" misc_feature 488..490 /gene="Crisp1" /gene_synonym="Aeg1; CRISP-1; SCP 1" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (Q03401.1); glycosylation site" misc_feature 623..787 /gene="Crisp1" /gene_synonym="Aeg1; CRISP-1; SCP 1" /note="Region: Crisp; pfam08562" /db_xref="CDD:462519" exon 128..244 /gene="Crisp1" /gene_synonym="Aeg1; CRISP-1; SCP 1" /inference="alignment:Splign:2.1.0" exon 245..332 /gene="Crisp1" /gene_synonym="Aeg1; CRISP-1; SCP 1" /inference="alignment:Splign:2.1.0" exon 333..478 /gene="Crisp1" /gene_synonym="Aeg1; CRISP-1; SCP 1" /inference="alignment:Splign:2.1.0" exon 479..573 /gene="Crisp1" /gene_synonym="Aeg1; CRISP-1; SCP 1" /inference="alignment:Splign:2.1.0" exon 574..662 /gene="Crisp1" /gene_synonym="Aeg1; CRISP-1; SCP 1" /inference="alignment:Splign:2.1.0" exon 663..1416 /gene="Crisp1" /gene_synonym="Aeg1; CRISP-1; SCP 1" /inference="alignment:Splign:2.1.0" regulatory 1391..1396 /regulatory_class="polyA_signal_sequence" /gene="Crisp1" /gene_synonym="Aeg1; CRISP-1; SCP 1" ORIGIN
gtcacctttcttcttcctgcagaacaacgcctcattctactctgaagccagcaccatggcattaatgcttgtgctgttcttcttggctgctgtactgcccccatcccttcttcaagatagctctcaggaaaatcgtcttgagaaactttcaaccactaaaatgtcagtccaagaagagattgtaagcaagcacaaccaattgagacgaatggtttctccatctggcagtgacttactaaaaatggaatggaactatgatgctcaagtgaatgctcagcaatgggcagacaagtgtacattcagtcacagtcctatagaactcaggacaactaatttaagatgtggggagaatttgttcatgtcatcttaccttgcatcatggtcttctgcaatccaaggatggtataatgaatacaaagatcttacatatgatgttggcccaaagcaacctgatagtgtggttggacattatactcaggttgtttggaactcaactttccaagttgcatgtggagttgctgaatgccctaaaaatccactgagatactattatgtttgtcactattgtcctgttggcaattatcaaggaaggctatacacaccttacactgcaggagaaccgtgtgccagttgtcctgatcactgtgaagatgggctatgcaccaatagttgtggacatgaagataagtatactaactgtaaatatctgaagaagatgctatcctgtgaacatgaacttcttaaaaaaggttgcaaagctacatgcctctgtgaaggcaaaattcactaaatttcctgtactcgtagccaggaccatgtagagaaagctcatactctctagttaggcttatcacatcccaccaagaaagtatagatttaggacattgaaataattccagatagtaaagattctgtttcttcttctatttctttctattttacagaaatcatttaccccaaatattttaaaataacaaatttgataatacctttgtaccttgacatatgaaatctgtgacacattttcggagtcaagtctagcccatgattatacattgtctgtatgactaaagtcactaaaactcatatgactaatgttccaagagcacaatgaagtaaaggaatagaaaacatatagttcctgtataatggtcagtcatcttttctagctctacctagtttactctctctggagaaaatcacattaatcgtcttttattttctttctcactattccttattcttcaaattcatcataatcagtggtttaaattctaaactactatttacattttagtttttttaaagaatgatataaaatgtaccttaacgagcagaatttatagtttgcttgttcaggggacaatgacctttgttgctttagaaaaataataaatcttaatcttggcatgttaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]