LOCUS       NM_009392               1434 bp    mRNA    linear   ROD 28-APR-2025
DEFINITION  Mus musculus T cell leukemia, homeobox 2 (Tlx2), mRNA.
ACCESSION   NM_009392 XM_620336
VERSION     NM_009392.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1434)
  AUTHORS   Desiderio,S., Vermeiren,S., Van Campenhout,C., Kricha,S., Malki,E.,
            Richts,S., Fletcher,E.V., Vanwelden,T., Schmidt,B.Z.,
            Henningfeld,K.A., Pieler,T., Woods,C.G., Nagy,V., Verfaillie,C. and
            Bellefroid,E.J.
  TITLE     Prdm12 Directs Nociceptive Sensory Neuron Development by Regulating
            the Expression of the NGF Receptor TrkA
  JOURNAL   Cell Rep 26 (13), 3522-3536 (2019)
   PUBMED   30917309
REFERENCE   2  (bases 1 to 1434)
  AUTHORS   Memic,F., Knoflach,V., Morarach,K., Sadler,R., Laranjeira,C.,
            Hjerling-Leffler,J., Sundstrom,E., Pachnis,V. and Marklund,U.
  TITLE     Transcription and Signaling Regulators in Developing Neuronal
            Subtypes of Mouse and Human Enteric Nervous System
  JOURNAL   Gastroenterology 154 (3), 624-636 (2018)
   PUBMED   29031500
REFERENCE   3  (bases 1 to 1434)
  AUTHORS   Thompson,C.L., Ng,L., Menon,V., Martinez,S., Lee,C.K.,
            Glattfelder,K., Sunkin,S.M., Henry,A., Lau,C., Dang,C.,
            Garcia-Lopez,R., Martinez-Ferre,A., Pombero,A., Rubenstein,J.L.R.,
            Wakeman,W.B., Hohmann,J., Dee,N., Sodt,A.J., Young,R., Smith,K.,
            Nguyen,T.N., Kidney,J., Kuan,L., Jeromin,A., Kaykas,A., Miller,J.,
            Page,D., Orta,G., Bernard,A., Riley,Z., Smith,S., Wohnoutka,P.,
            Hawrylycz,M.J., Puelles,L. and Jones,A.R.
  TITLE     A high-resolution spatiotemporal atlas of gene expression of the
            developing mouse brain
  JOURNAL   Neuron 83 (2), 309-323 (2014)
   PUBMED   24952961
REFERENCE   4  (bases 1 to 1434)
  AUTHORS   Neco,P., Rose,B., Huynh,N., Zhang,R., Bridge,J.H., Philipson,K.D.
            and Goldhaber,J.I.
  TITLE     Sodium-calcium exchange is essential for effective triggering of
            calcium release in mouse heart
  JOURNAL   Biophys J 99 (3), 755-764 (2010)
   PUBMED   20682252
  REMARK    GeneRIF: These results suggest that high subsarcolemmal Ca2+ is
            required to ensure synchronous triggering with short spark latency
            in the absence of NCX.
REFERENCE   5  (bases 1 to 1434)
  AUTHORS   Aoki,T., Jusuf,A.A., Iitsuka,Y., Isono,K., Tokuhisa,T. and
            Hatano,M.
  TITLE     Ncx (Enx, Hox11L.1) is required for neuronal cell death in enteric
            ganglia of mice
  JOURNAL   J Pediatr Surg 42 (6), 1081-1088 (2007)
   PUBMED   17560225
  REMARK    GeneRIF: Ncx participates in normal developmental cell death of
            enteric neurons. Ncx may modulate, if not directly target,
            expression of the caspase-3 at the transcriptional level to
            participate in neuronal cell death in the enteric nervous system.
REFERENCE   6  (bases 1 to 1434)
  AUTHORS   Roberts,C.W., Sonder,A.M., Lumsden,A. and Korsmeyer,S.J.
  TITLE     Development expression of Hox11 and specification of splenic cell
            fate
  JOURNAL   Am J Pathol 146 (5), 1089-1101 (1995)
   PUBMED   7747804
REFERENCE   7  (bases 1 to 1434)
  AUTHORS   Wen,X.Y., Tang,S. and Breitman,M.L.
  TITLE     Genetic mapping of two mouse homeobox genes Tlx-1 and Tlx-2 to
            murine chromosomes 19 and 6
  JOURNAL   Genomics 24 (2), 388-390 (1994)
   PUBMED   7698766
REFERENCE   8  (bases 1 to 1434)
  AUTHORS   Raju,K., Tang,S., Dube,I.D., Kamel-Reid,S., Bryce,D.M. and
            Breitman,M.L.
  TITLE     Characterization and developmental expression of Tlx-1, the murine
            homolog of HOX11
  JOURNAL   Mech Dev 44 (1), 51-64 (1993)
   PUBMED   7908826
REFERENCE   9  (bases 1 to 1434)
  AUTHORS   Dear,T.N., Sanchez-Garcia,I. and Rabbitts,T.H.
  TITLE     The HOX11 gene encodes a DNA-binding nuclear transcription factor
            belonging to a distinct family of homeobox genes
  JOURNAL   Proc Natl Acad Sci U S A 90 (10), 4431-4435 (1993)
   PUBMED   8099440
REFERENCE   10 (bases 1 to 1434)
  AUTHORS   Kennedy,M.A., Gonzalez-Sarmiento,R., Kees,U.R., Lampert,F.,
            Dear,N., Boehm,T. and Rabbitts,T.H.
  TITLE     HOX11, a homeobox-containing T-cell oncogene on human chromosome
            10q24
  JOURNAL   Proc Natl Acad Sci U S A 88 (20), 8900-8904 (1991)
   PUBMED   1681546
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AK013072.1, M75953.1 and AC134899.4.
            
            On Jul 18, 2005 this sequence version replaced NM_009392.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: M75953.1, BC138240.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849375, SAMN00849376
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-82                AK013072.1         1-82
            83-1076             M75953.1           1-994
            1077-1434           AC134899.4         27846-28203
FEATURES             Location/Qualifiers
     source          1..1434
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="6"
                     /map="6 35.94 cM"
     gene            1..1434
                     /gene="Tlx2"
                     /gene_synonym="Enx; Hox11L.1; Hox11l1; NCX; Ncx1; Tlx1l1;
                     Tlx1l2"
                     /note="T cell leukemia, homeobox 2"
                     /db_xref="GeneID:21909"
                     /db_xref="MGI:MGI:1350935"
     exon            1..546
                     /gene="Tlx2"
                     /gene_synonym="Enx; Hox11L.1; Hox11l1; NCX; Ncx1; Tlx1l1;
                     Tlx1l2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    57..59
                     /gene="Tlx2"
                     /gene_synonym="Enx; Hox11L.1; Hox11l1; NCX; Ncx1; Tlx1l1;
                     Tlx1l2"
                     /note="upstream in-frame stop codon"
     CDS             147..1001
                     /gene="Tlx2"
                     /gene_synonym="Enx; Hox11L.1; Hox11l1; NCX; Ncx1; Tlx1l1;
                     Tlx1l2"
                     /note="enteric neuron homeobox protein; PMUR10F; homeobox
                     TLX-2; homeobox protein Hox-11L1; homeo box 11-like 1"
                     /codon_start=1
                     /product="T-cell leukemia homeobox protein 2"
                     /protein_id="NP_033418.1"
                     /db_xref="CCDS:CCDS20269.1"
                     /db_xref="GeneID:21909"
                     /db_xref="MGI:MGI:1350935"
                     /translation="

MEPAVLAAHHLPHHEPISFGIDQILSGPEPPGGGLGPGQSGQSHGESAAFSSGFHGASGYAPAGSLASLPRGSGVGPGGVIRVPAHRPLPVPPPSGAAPAVPGPSGLGGAGGLAGLTFPWMDSGRRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLASVV"

     misc_feature    204..302
                     /gene="Tlx2"
                     /gene_synonym="Enx; Hox11L.1; Hox11l1; NCX; Ncx1; Tlx1l1;
                     Tlx1l2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q61663.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    378..458
                     /gene="Tlx2"
                     /gene_synonym="Enx; Hox11L.1; Hox11l1; NCX; Ncx1; Tlx1l1;
                     Tlx1l2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q61663.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    564..644
                     /gene="Tlx2"
                     /gene_synonym="Enx; Hox11L.1; Hox11l1; NCX; Ncx1; Tlx1l1;
                     Tlx1l2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q61663.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    618..788
                     /gene="Tlx2"
                     /gene_synonym="Enx; Hox11L.1; Hox11l1; NCX; Ncx1; Tlx1l1;
                     Tlx1l2"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            547..784
                     /gene="Tlx2"
                     /gene_synonym="Enx; Hox11L.1; Hox11l1; NCX; Ncx1; Tlx1l1;
                     Tlx1l2"
                     /inference="alignment:Splign:2.1.0"
     exon            785..1434
                     /gene="Tlx2"
                     /gene_synonym="Enx; Hox11L.1; Hox11l1; NCX; Ncx1; Tlx1l1;
                     Tlx1l2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ggatgttgctgtcccgggggccccggcgcatggccgtggccagccccgcgggcccctgaagcctctgccctgagcgcgccgccgccgggctcccgcagccgtcagaaacaccttttccagtcatccaacctctcaggcttggacccatggagcccgcggtgttggctgcgcaccaccttccgcaccacgaacccatcagcttcggcatcgatcagatcctgagcggtcccgaacccccggggggcggtctgggtcccggtcagtcgggccagagccacggagaaagtgcggcgttttccagtggattccacggagcctcgggctatgctccagccggctcgctggcctccttgcctagaggctcgggagtgggccccggcggcgtgatccgcgtccccgcgcaccgcccgctgcccgtgccgccaccctcgggtgcggcccccgccgtgcccggaccctctggtttgggtggcgccgggggcctagcgggactcaccttcccctggatggacagcggccgccgctttgcaaaggacaggctcacggctgcgctctcgcccttctctgggacacgtcgcataggccatccctaccaaaaccggacccccccgaagcgcaagaagccgcgcacctccttttcccgctcgcaggtgctggagctggagcgccgcttcttgcgccagaagtacctggcctccgcagagagggcggcgctggccaaggccctgcgcatgacggacgcgcaggtcaagacctggttccagaaccgacgcaccaagtggcggcgccagaccgcggaggagcgcgaggccgagcggcaccgcgctggtcgcctgctgctgcacctgcagcaagacgcgctgccccggccgctgcggccaccgctgccaccggacccgctttgcctgcacaactcgtcgctcttcgcgctgcagaatctgcagccctgggcggaagacaacaaggtggcttcggtgtccgggctcgcctcggtggtgtgaccgacacctgcccgacgagcgccaacgtggccgggtgccgtaccgccagcgaagagtgaggagcagaaggcccgcggcccgcggccgtcctctgaggctctttggtcatcagtggcccctggcccacactctgactccgcccttcaaggttttgttttgttttgtttaaaaaaaaaaaccccgctgagatgtgggttgcaagagcaacctgcaggattgtggatgaagcagggaccctgcaaggctgcgactttgccctgagtgggctcagagctcaggtcctgctgggaagggaccacagagctggtgtaaaggcagatatcaaaggacagcgggggaggggtaatggaagaggcgctggcagtagagaatgtggcctactgtgacagggacctcgtccctcatctgtaaaacaataactaaggattccttc

//