GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-17 17:33:14, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_008178               1783 bp    mRNA    linear   ROD 29-JUL-2025
DEFINITION  Mus musculus GS homeobox 1 (Gsx1), mRNA.
ACCESSION   NM_008178
VERSION     NM_008178.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1783)
  AUTHORS   Shen,X., Anirudhan,J., Fatima,A., Plant,E., Szemes,T., Bouveret,Z.,
            Keruzore,M., Kricha,S., Nan,X., Sabate San Jose,A., Bianchin,S.,
            Veraghen,B., Delhaye,L.P., Mian,B.A., Khalid,L.B., Ali,F.,
            Zahra,H., Ali,A., Toft,M., Dieu,M., Achouri,Y., Li,M., Renard,P.,
            Van Lint,C., Poulard,C., Iqbal,Z. and Bellefroid,E.J.
  TITLE     Evidence That Dmrta2 Acts through Repression of Pax6 in Cortical
            Patterning and Identification of a Mutation Impairing DNA
            Recognition Associated with Microcephaly in Human
  JOURNAL   eNeuro 12 (6) (2025)
   PUBMED   40541527
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1783)
  AUTHORS   Tweedie,L., Riccetti,M.R., Cain,B., Qin,S., Salomone,J., Webb,J.A.,
            Riesenberg,A., Ehrman,L.A., Waclaw,R.R., Kovall,R.A., Gebelein,B.
            and Campbell,K.
  TITLE     Modelling a pathological GSX2 variant that selectively alters DNA
            binding reveals hypomorphic mouse brain defects
  JOURNAL   Dis Model Mech 18 (2) (2025)
   PUBMED   39882631
REFERENCE   3  (bases 1 to 1783)
  AUTHORS   Talley,M.J., Nardini,D., Ehrman,L.A., Lu,Q.R. and Waclaw,R.R.
  TITLE     Distinct requirements for Tcf3 and Tcf12 during oligodendrocyte
            development in the mouse telencephalon
  JOURNAL   Neural Dev 18 (1), 5 (2023)
   PUBMED   37684687
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1783)
  AUTHORS   Manuel,M., Tan,K.B., Kozic,Z., Molinek,M., Marcos,T.S.,
            Razak,M.F.A., Dobolyi,D., Dobie,R., Henderson,B.E.P.,
            Henderson,N.C., Chan,W.K., Daw,M.I., Mason,J.O. and Price,D.J.
  TITLE     Pax6 limits the competence of developing cerebral cortical cells to
            respond to inductive intercellular signals
  JOURNAL   PLoS Biol 20 (9), e3001563 (2022)
   PUBMED   36067211
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1783)
  AUTHORS   Su-Feher,L., Rubin,A.N., Silberberg,S.N., Catta-Preta,R., Lim,K.J.,
            Ypsilanti,A.R., Zdilar,I., McGinnis,C.S., McKinsey,G.L.,
            Rubino,T.E. Jr., Hawrylycz,M.J., Thompson,C., Gartner,Z.J.,
            Puelles,L., Zeng,H., Rubenstein,J.L.R. and Nord,A.S.
  TITLE     Single cell enhancer activity distinguishes GABAergic and
            cholinergic lineages in embryonic mouse basal ganglia
  JOURNAL   Proc Natl Acad Sci U S A 119 (15), e2108760119 (2022)
   PUBMED   35377797
REFERENCE   6  (bases 1 to 1783)
  AUTHORS   Mastick,G.S., Davis,N.M., Andrew,G.L. and Easter,S.S. Jr.
  TITLE     Pax-6 functions in boundary formation and axon guidance in the
            embryonic mouse forebrain
  JOURNAL   Development 124 (10), 1985-1997 (1997)
   PUBMED   9169845
REFERENCE   7  (bases 1 to 1783)
  AUTHORS   Li,H., Zeitler,P.S., Valerius,M.T., Small,K. and Potter,S.S.
  TITLE     Gsh-1, an orphan Hox gene, is required for normal pituitary
            development
  JOURNAL   EMBO J 15 (4), 714-724 (1996)
   PUBMED   8631293
REFERENCE   8  (bases 1 to 1783)
  AUTHORS   Sommers,C.L., Huang,K., Shores,E.W., Grinberg,A., Charlick,D.A.,
            Kozak,C.A. and Love,P.E.
  TITLE     Murine txk: a protein tyrosine kinase gene regulated by T cell
            activation
  JOURNAL   Oncogene 11 (2), 245-251 (1995)
   PUBMED   7542761
REFERENCE   9  (bases 1 to 1783)
  AUTHORS   Valerius,M.T., Li,H., Stock,J.L., Weinstein,M., Kaur,S., Singh,G.
            and Potter,S.S.
  TITLE     Gsh-1: a novel murine homeobox gene expressed in the central
            nervous system
  JOURNAL   Dev Dyn 203 (3), 337-351 (1995)
   PUBMED   8589431
REFERENCE   10 (bases 1 to 1783)
  AUTHORS   Singh,G., Kaur,S., Stock,J.L., Jenkins,N.A., Gilbert,D.J.,
            Copeland,N.G. and Potter,S.S.
  TITLE     Identification of 10 murine homeobox genes
  JOURNAL   Proc Natl Acad Sci U S A 88 (23), 10706-10710 (1991)
   PUBMED   1683707
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC115847.19.
            
            On Oct 27, 2022 this sequence version replaced NM_008178.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U21224.1, BC137769.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164131, SAMN01164132
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-617               AC115847.19        105556-106172
            618-1783            AC115847.19        106652-107817
FEATURES             Location/Qualifiers
     source          1..1783
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="5"
                     /map="5 86.79 cM"
     gene            1..1783
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /note="GS homeobox 1"
                     /db_xref="GeneID:14842"
                     /db_xref="MGI:MGI:95842"
     exon            1..617
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /inference="alignment:Splign:2.1.0"
     CDS             209..994
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /note="homeobox protein GSH-1; genomic screened homeo box
                     1"
                     /codon_start=1
                     /product="GS homeobox 1"
                     /protein_id="NP_032204.1"
                     /db_xref="CCDS:CCDS19877.1"
                     /db_xref="GeneID:14842"
                     /db_xref="MGI:MGI:95842"
                     /translation="
MPRSFLVDSLVLREASDKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHSVSPGVAHGPAAAAAAAALYQTSYPLPDPRQFHCISVDSSSNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGAGAGAGGGAPQGCKCSSLSSAKCSEDDDELPMSPSSSGKDDRDLTVTP"
     misc_feature    209..268
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /note="propagated from UniProtKB/Swiss-Prot (P31315.2);
                     Region: SNAG domain. /evidence=ECO:0000250"
     misc_feature    647..817
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    809..991
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /note="propagated from UniProtKB/Swiss-Prot (P31315.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            618..1783
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1764..1769
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /note="hexamer: AATAAA"
     polyA_site      1783
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /note="major polyA site"
ORIGIN      
accactagcgctggccagcacctcgcccgctccgggaggtgcccgcagcagcagccaaggtgattccagcccgggcttgagccgcgcgtggagcctccggggcccgggaagctgcgggtggccgcggccaggggaagctacgacaggatctgcagttccctcgggctccaggggcgggctggcggcaggtggaccgcgcgccggagccatgccgcgctccttcctggtggattcccttgtgctgcgggaagccagcgacaagaaggctccggagggcagcccgccaccgctcttcccctacgcggtcccgccgccgcacgcgctccacggcctctcgccgggcgcctgccacgcgcgcaaggccggcttgctgtgcgtgtgtcccctctgtgtcaccgcttcgcagctgcacgggccccccgggccgccggcactgccgctactcaaggcgtccttccctcccttcggatcgcagtactgccacgcacccctgggccgccagcactccgtgtcccctggagtcgcccacggcccggctgcggccgcagcagctgctgcactctaccagacctcctacccgctgccggatcccagacagtttcactgcatctctgtggacagcagctcgaaccagctgcccagcagcaagaggatgcggacggcgttcaccagcacacagctcctggagctggagcgagagttcgcctccaacatgtacctctcccgcctgcggcgcatcgagatcgcgacctatctgaacctgtccgagaagcaggtgaagatctggtttcagaaccgccgggtgaagcacaagaaagaaggcaaaggcagtaaccaccgcggcggagctggggcgggggccggcgggggcgcaccgcaaggctgcaagtgctcttcgctctcctcagccaaatgctcagaggacgacgacgaattgcccatgtctccatcttcctccgggaaggatgacagagatctcacagtcactccgtaggtgcgccttttagaggaccattggtttccccaccccccaccccgacccttcccgcactggtccccaggcacccgctggccaaccgacggatttcgttgggctttgcggtggtgcgcagctttaggcagagctaagaccttagcagacacttgaagacagtgcccctgtcccttgggcttcagggtgtttaggaggactccaagcgatgaaggctgagtcctcctcctaggacacagcctcttctcccaggcacgcaggccggagcacagcgccttgctgaccgccagcgcctcttcgcctgccaactctgggctggttcaagcttcctcggttccactattctctccttctcggtcaatctgggcttttcactccgcgagtggctgtttgcttttcttttaacatttctttcttgcccccaactcgtctccccccactgtggtcctttatgcaacacgtctatggacttaacttttccttccctcctcaggaagtctctcccttctgtccgtttgtcccttaaacagggatcaggtcttgctgttcgaagaagtccccctagcagagagaactgtctcacatggtattgtattggggaaaatgactctgtttccaatacgctctaaacccccttcaaatgaagccgctgtaaccaacctctccccattgtccaggccccgactccctctggggactgactgactgtgtcattgtatcgtctctgtaatgccagaagatatttatttatttatttatgtacaaaattttaaataaactttttttttctta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]