2025-09-17 03:24:26, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_008178 1783 bp mRNA linear ROD 12-JUN-2025 DEFINITION Mus musculus GS homeobox 1 (Gsx1), mRNA. ACCESSION NM_008178 VERSION NM_008178.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1783) AUTHORS Tweedie,L., Riccetti,M.R., Cain,B., Qin,S., Salomone,J., Webb,J.A., Riesenberg,A., Ehrman,L.A., Waclaw,R.R., Kovall,R.A., Gebelein,B. and Campbell,K. TITLE Modelling a pathological GSX2 variant that selectively alters DNA binding reveals hypomorphic mouse brain defects JOURNAL Dis Model Mech 18 (2) (2025) PUBMED 39882631 REFERENCE 2 (bases 1 to 1783) AUTHORS Talley,M.J., Nardini,D., Ehrman,L.A., Lu,Q.R. and Waclaw,R.R. TITLE Distinct requirements for Tcf3 and Tcf12 during oligodendrocyte development in the mouse telencephalon JOURNAL Neural Dev 18 (1), 5 (2023) PUBMED 37684687 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1783) AUTHORS Manuel,M., Tan,K.B., Kozic,Z., Molinek,M., Marcos,T.S., Razak,M.F.A., Dobolyi,D., Dobie,R., Henderson,B.E.P., Henderson,N.C., Chan,W.K., Daw,M.I., Mason,J.O. and Price,D.J. TITLE Pax6 limits the competence of developing cerebral cortical cells to respond to inductive intercellular signals JOURNAL PLoS Biol 20 (9), e3001563 (2022) PUBMED 36067211 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1783) AUTHORS Su-Feher,L., Rubin,A.N., Silberberg,S.N., Catta-Preta,R., Lim,K.J., Ypsilanti,A.R., Zdilar,I., McGinnis,C.S., McKinsey,G.L., Rubino,T.E. Jr., Hawrylycz,M.J., Thompson,C., Gartner,Z.J., Puelles,L., Zeng,H., Rubenstein,J.L.R. and Nord,A.S. TITLE Single cell enhancer activity distinguishes GABAergic and cholinergic lineages in embryonic mouse basal ganglia JOURNAL Proc Natl Acad Sci U S A 119 (15), e2108760119 (2022) PUBMED 35377797 REFERENCE 5 (bases 1 to 1783) AUTHORS Bedogni,F. and Hevner,R.F. TITLE Cell-Type-Specific Gene Expression in Developing Mouse Neocortex: Intermediate Progenitors Implicated in Axon Development JOURNAL Front Mol Neurosci 14, 686034 (2021) PUBMED 34321999 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1783) AUTHORS Mastick,G.S., Davis,N.M., Andrew,G.L. and Easter,S.S. Jr. TITLE Pax-6 functions in boundary formation and axon guidance in the embryonic mouse forebrain JOURNAL Development 124 (10), 1985-1997 (1997) PUBMED 9169845 REFERENCE 7 (bases 1 to 1783) AUTHORS Li,H., Zeitler,P.S., Valerius,M.T., Small,K. and Potter,S.S. TITLE Gsh-1, an orphan Hox gene, is required for normal pituitary development JOURNAL EMBO J 15 (4), 714-724 (1996) PUBMED 8631293 REFERENCE 8 (bases 1 to 1783) AUTHORS Sommers,C.L., Huang,K., Shores,E.W., Grinberg,A., Charlick,D.A., Kozak,C.A. and Love,P.E. TITLE Murine txk: a protein tyrosine kinase gene regulated by T cell activation JOURNAL Oncogene 11 (2), 245-251 (1995) PUBMED 7542761 REFERENCE 9 (bases 1 to 1783) AUTHORS Valerius,M.T., Li,H., Stock,J.L., Weinstein,M., Kaur,S., Singh,G. and Potter,S.S. TITLE Gsh-1: a novel murine homeobox gene expressed in the central nervous system JOURNAL Dev Dyn 203 (3), 337-351 (1995) PUBMED 8589431 REFERENCE 10 (bases 1 to 1783) AUTHORS Singh,G., Kaur,S., Stock,J.L., Jenkins,N.A., Gilbert,D.J., Copeland,N.G. and Potter,S.S. TITLE Identification of 10 murine homeobox genes JOURNAL Proc Natl Acad Sci U S A 88 (23), 10706-10710 (1991) PUBMED 1683707 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC115847.19. On Oct 27, 2022 this sequence version replaced NM_008178.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: U21224.1, BC137769.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164131, SAMN01164132 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-617 AC115847.19 105556-106172 618-1783 AC115847.19 106652-107817 FEATURES Location/Qualifiers source 1..1783 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="5" /map="5 86.79 cM" gene 1..1783 /gene="Gsx1" /gene_synonym="Gsh-1; Gsh1" /note="GS homeobox 1" /db_xref="GeneID:14842" /db_xref="MGI:MGI:95842" exon 1..617 /gene="Gsx1" /gene_synonym="Gsh-1; Gsh1" /inference="alignment:Splign:2.1.0" CDS 209..994 /gene="Gsx1" /gene_synonym="Gsh-1; Gsh1" /note="homeobox protein GSH-1; genomic screened homeo box 1" /codon_start=1 /product="GS homeobox 1" /protein_id="NP_032204.1" /db_xref="CCDS:CCDS19877.1" /db_xref="GeneID:14842" /db_xref="MGI:MGI:95842" /translation="
MPRSFLVDSLVLREASDKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHSVSPGVAHGPAAAAAAAALYQTSYPLPDPRQFHCISVDSSSNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGAGAGAGGGAPQGCKCSSLSSAKCSEDDDELPMSPSSSGKDDRDLTVTP"
misc_feature 209..268 /gene="Gsx1" /gene_synonym="Gsh-1; Gsh1" /note="propagated from UniProtKB/Swiss-Prot (P31315.2); Region: SNAG domain. /evidence=ECO:0000250" misc_feature 647..817 /gene="Gsx1" /gene_synonym="Gsh-1; Gsh1" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" misc_feature 809..991 /gene="Gsx1" /gene_synonym="Gsh-1; Gsh1" /note="propagated from UniProtKB/Swiss-Prot (P31315.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 618..1783 /gene="Gsx1" /gene_synonym="Gsh-1; Gsh1" /inference="alignment:Splign:2.1.0" regulatory 1764..1769 /regulatory_class="polyA_signal_sequence" /gene="Gsx1" /gene_synonym="Gsh-1; Gsh1" /note="hexamer: AATAAA" polyA_site 1783 /gene="Gsx1" /gene_synonym="Gsh-1; Gsh1" /note="major polyA site" ORIGIN
accactagcgctggccagcacctcgcccgctccgggaggtgcccgcagcagcagccaaggtgattccagcccgggcttgagccgcgcgtggagcctccggggcccgggaagctgcgggtggccgcggccaggggaagctacgacaggatctgcagttccctcgggctccaggggcgggctggcggcaggtggaccgcgcgccggagccatgccgcgctccttcctggtggattcccttgtgctgcgggaagccagcgacaagaaggctccggagggcagcccgccaccgctcttcccctacgcggtcccgccgccgcacgcgctccacggcctctcgccgggcgcctgccacgcgcgcaaggccggcttgctgtgcgtgtgtcccctctgtgtcaccgcttcgcagctgcacgggccccccgggccgccggcactgccgctactcaaggcgtccttccctcccttcggatcgcagtactgccacgcacccctgggccgccagcactccgtgtcccctggagtcgcccacggcccggctgcggccgcagcagctgctgcactctaccagacctcctacccgctgccggatcccagacagtttcactgcatctctgtggacagcagctcgaaccagctgcccagcagcaagaggatgcggacggcgttcaccagcacacagctcctggagctggagcgagagttcgcctccaacatgtacctctcccgcctgcggcgcatcgagatcgcgacctatctgaacctgtccgagaagcaggtgaagatctggtttcagaaccgccgggtgaagcacaagaaagaaggcaaaggcagtaaccaccgcggcggagctggggcgggggccggcgggggcgcaccgcaaggctgcaagtgctcttcgctctcctcagccaaatgctcagaggacgacgacgaattgcccatgtctccatcttcctccgggaaggatgacagagatctcacagtcactccgtaggtgcgccttttagaggaccattggtttccccaccccccaccccgacccttcccgcactggtccccaggcacccgctggccaaccgacggatttcgttgggctttgcggtggtgcgcagctttaggcagagctaagaccttagcagacacttgaagacagtgcccctgtcccttgggcttcagggtgtttaggaggactccaagcgatgaaggctgagtcctcctcctaggacacagcctcttctcccaggcacgcaggccggagcacagcgccttgctgaccgccagcgcctcttcgcctgccaactctgggctggttcaagcttcctcggttccactattctctccttctcggtcaatctgggcttttcactccgcgagtggctgtttgcttttcttttaacatttctttcttgcccccaactcgtctccccccactgtggtcctttatgcaacacgtctatggacttaacttttccttccctcctcaggaagtctctcccttctgtccgtttgtcccttaaacagggatcaggtcttgctgttcgaagaagtccccctagcagagagaactgtctcacatggtattgtattggggaaaatgactctgtttccaatacgctctaaacccccttcaaatgaagccgctgtaaccaacctctccccattgtccaggccccgactccctctggggactgactgactgtgtcattgtatcgtctctgtaatgccagaagatatttatttatttatttatgtacaaaattttaaataaactttttttttctta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]