LOCUS       NM_001425466            1801 bp    mRNA    linear   ROD 18-NOV-2023
DEFINITION  Mus musculus MAX-like protein X (Mlx), transcript variant 5, mRNA.
ACCESSION   NM_001425466
VERSION     NM_001425466.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1801)
  AUTHORS   Wang H, Stevens T, Lu J, Airik M, Airik R and Prochownik EV.
  TITLE     Disruption of Multiple Overlapping Functions Following Stepwise
            Inactivation of the Extended Myc Network
  JOURNAL   Cells 11 (24), 4087 (2022)
   PUBMED   36552851
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1801)
  AUTHORS   Wang H, Lu J, Alencastro F, Roberts A, Fiedor J, Carroll P,
            Eisenman RN, Ranganathan S, Torbenson M, Duncan AW and Prochownik
            EV.
  TITLE     Coordinated Cross-Talk Between the Myc and Mlx Networks in Liver
            Regeneration and Neoplasia
  JOURNAL   Cell Mol Gastroenterol Hepatol 13 (6), 1785-1804 (2022)
   PUBMED   35259493
REFERENCE   3  (bases 1 to 1801)
  AUTHORS   Carroll PA, Freie BW, Cheng PF, Kasinathan S, Gu H, Hedrich T,
            Dowdle JA, Venkataramani V, Ramani V, Wu X, Raftery D, Shendure J,
            Ayer DE, Muller CH and Eisenman RN.
  TITLE     The glucose-sensing transcription factor MLX balances metabolism
            and stress to suppress apoptosis and maintain spermatogenesis
  JOURNAL   PLoS Biol 19 (10), e3001085 (2021)
   PUBMED   34669700
  REMARK    GeneRIF: The glucose-sensing transcription factor MLX balances
            metabolism and stress to suppress apoptosis and maintain
            spermatogenesis.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1801)
  AUTHORS   Hunt LC, Xu B, Finkelstein D, Fan Y, Carroll PA, Cheng PF, Eisenman
            RN and Demontis F.
  TITLE     The glucose-sensing transcription factor MLX promotes myogenesis
            via myokine signaling
  JOURNAL   Genes Dev 29 (23), 2475-2489 (2015)
   PUBMED   26584623
  REMARK    GeneRIF: MLX promotes myogenesis not via an adjustment of glucose
            metabolism but rather by inducing the expression of several
            myokines, including insulin-like growth factor 2 (IGF2)
REFERENCE   5  (bases 1 to 1801)
  AUTHORS   Thompson CL, Ng L, Menon V, Martinez S, Lee CK, Glattfelder K,
            Sunkin SM, Henry A, Lau C, Dang C, Garcia-Lopez R, Martinez-Ferre
            A, Pombero A, Rubenstein JLR, Wakeman WB, Hohmann J, Dee N, Sodt
            AJ, Young R, Smith K, Nguyen TN, Kidney J, Kuan L, Jeromin A,
            Kaykas A, Miller J, Page D, Orta G, Bernard A, Riley Z, Smith S,
            Wohnoutka P, Hawrylycz MJ, Puelles L and Jones AR.
  TITLE     A high-resolution spatiotemporal atlas of gene expression of the
            developing mouse brain
  JOURNAL   Neuron 83 (2), 309-323 (2014)
   PUBMED   24952961
REFERENCE   6  (bases 1 to 1801)
  AUTHORS   Stoeckman AK, Ma L and Towle HC.
  TITLE     Mlx is the functional heteromeric partner of the carbohydrate
            response element-binding protein in glucose regulation of lipogenic
            enzyme genes
  JOURNAL   J Biol Chem 279 (15), 15662-15669 (2004)
   PUBMED   14742444
REFERENCE   7  (bases 1 to 1801)
  AUTHORS   Eilers AL, Sundwall E, Lin M, Sullivan AA and Ayer DE.
  TITLE     A novel heterodimerization domain, CRM1, and 14-3-3 control
            subcellular localization of the MondoA-Mlx heterocomplex
  JOURNAL   Mol Cell Biol 22 (24), 8514-8526 (2002)
   PUBMED   12446771
REFERENCE   8  (bases 1 to 1801)
  AUTHORS   Meroni G, Cairo S, Merla G, Messali S, Brent R, Ballabio A and
            Reymond A.
  TITLE     Mlx, a new Max-like bHLHZip family member: the center stage of a
            novel transcription factors regulatory pathway?
  JOURNAL   Oncogene 19 (29), 3266-3277 (2000)
   PUBMED   10918583
REFERENCE   9  (bases 1 to 1801)
  AUTHORS   Billin AN, Eilers AL, Queva C and Ayer DE.
  TITLE     Mlx, a novel Max-like BHLHZip protein that interacts with the Max
            network of transcription factors
  JOURNAL   J Biol Chem 274 (51), 36344-36350 (1999)
   PUBMED   10593926
REFERENCE   10 (bases 1 to 1801)
  AUTHORS   Bjerknes M and Cheng H.
  TITLE     TCFL4: a gene at 17q21.1 encoding a putative basic helix-loop-helix
            leucine-zipper transcription factor
  JOURNAL   Gene 181 (1-2), 7-11 (1996)
   PUBMED   8973301
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BX255926.10.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR7652917.934981.1,
                                           SRR17253012.5139014.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849377, SAMN00849380
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-78                BX255926.10        19962-20039
            79-115              BX255926.10        20426-20462
            116-193             BX255926.10        20920-20997
            194-300             BX255926.10        21270-21376
            301-400             BX255926.10        21605-21704
            401-500             BX255926.10        21891-21990
            501-702             BX255926.10        22340-22541
            703-1801            BX255926.10        23781-24879
FEATURES             Location/Qualifiers
     source          1..1801
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="11"
                     /map="11 64.18 cM"
     gene            1..1801
                     /gene="Mlx"
                     /gene_synonym="bHLHd13; Tcfl4; Tf4"
                     /note="MAX-like protein X"
                     /db_xref="GeneID:21428"
                     /db_xref="MGI:MGI:108398"
     exon            1..78
                     /gene="Mlx"
                     /gene_synonym="bHLHd13; Tcfl4; Tf4"
                     /inference="alignment:Splign:2.1.0"
     CDS             37..759
                     /gene="Mlx"
                     /gene_synonym="bHLHd13; Tcfl4; Tf4"
                     /note="isoform 5 is encoded by transcript variant 5;
                     transcription factor-like 4; protein BigMax; transcription
                     factor-like protein 4; BigMax alpha; MAX-like bHLHZIP
                     protein"
                     /codon_start=1
                     /product="max-like protein X isoform 5"
                     /protein_id="NP_001412395.1"
                     /db_xref="GeneID:21428"
                     /db_xref="MGI:MGI:108398"
                     /translation="

MTEPGASPEDPWVKVEYAYSDNSLDPESTHKGSVVSRANSIGSTSASSVPNTDDEDSDYQQESYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCEPQTLREIVIGVLHQLKNQLY"

     exon            79..115
                     /gene="Mlx"
                     /gene_synonym="bHLHd13; Tcfl4; Tf4"
                     /inference="alignment:Splign:2.1.0"
     exon            116..193
                     /gene="Mlx"
                     /gene_synonym="bHLHd13; Tcfl4; Tf4"
                     /inference="alignment:Splign:2.1.0"
     exon            194..300
                     /gene="Mlx"
                     /gene_synonym="bHLHd13; Tcfl4; Tf4"
                     /inference="alignment:Splign:2.1.0"
     exon            301..400
                     /gene="Mlx"
                     /gene_synonym="bHLHd13; Tcfl4; Tf4"
                     /inference="alignment:Splign:2.1.0"
     exon            401..500
                     /gene="Mlx"
                     /gene_synonym="bHLHd13; Tcfl4; Tf4"
                     /inference="alignment:Splign:2.1.0"
     exon            501..702
                     /gene="Mlx"
                     /gene_synonym="bHLHd13; Tcfl4; Tf4"
                     /inference="alignment:Splign:2.1.0"
     exon            703..1801
                     /gene="Mlx"
                     /gene_synonym="bHLHd13; Tcfl4; Tf4"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

agtccgctggcttgtttccggttcggtaggttcacgatgacggagccgggcgcctctccggaggacccttgggtcaaggtcgagtatgcctacagtgacaacagcctggatcctgaaagcacccacaaggggagtgtagtgtccagagctaatagcatcggctccaccagtgcctcttctgtccccaacacagatgatgaggacagtgattatcagcaggagtcctacaaggagtcctacaaagaccggaggcggcgtgcgcacactcaggctgaacagaagagaagggatgctattaagagaggctatgatgaccttcagaccattgtccctacctgccagcagcaggatttctccattggctcccaaaaactcagcaaagccatcgttctacagaagaccattgactacatccagtttttacacaaggagaagaaaaagcaggaggaagaagtatccacactgcgcaaggacgtcacagccttgaagataatgaaagtgaactatgagcaaatcgtgaaggcacatcaggacaaccctcatgagggagaggaccaggtctctgaccaggtcaagttcaacgtctttcaaggcatcatggactccctcttccagtctttcaacgcctctatctctgtggccagcttccaggagctctcagcttgtgtcttcagctggattgaggaacactgtgagccacagactctacgagagattgtgatcggtgtccttcatcagttgaaaaaccaactctactgattgcccatggaagcctgcagagcagccaacaagaggcctttgagagtgtggccatggaactaactgctgggcctatgagactggcctgcaacacctcacaccggtcagctggtttctacttggtgtttggttttcccaaccccacttcagcttcggtggggttgagtgttttgtgaaagcttctgaataatttattatattgtccacaatgttgaacctacccaaccttcccctttctaggaaaagcctctaggacaagagtctgttcagggagcctcacagaaccctgagcccctcagccttttctctacccactgggttcctgctcacaatctatatacataatttggaaatcgtttgcctctgcttggtctcttgggcaacacttggctcaagtttgggtattttggcagttcttaagttagaaaaaaggaaaagaaatagccctatggccatgaagggtaaaaggccaccttgtgcctaggctagggctgtgtggtcaatactaagtaaggccagggtattctagccagctcagggtagggctgcctgaccctgctaccctcatgttctgctgcccacttcagctgctgtaggtgctacaggaaacagcgtcccatcagctcttgccctgtcttcccaaaggcaaaggcagcattacatatttgaatttatcttctaaatacccacagtgcatttttgttatatgcagtttcccaaacttcttagcagacctccaaagcagccccagcctcttctgcataatgtgtgtatctgccccaccagtgtgttgtctccatttctcctggggcctggggatagagttaggtgggacaggagatcctcaagtcttctgggggtaggccagggcgatcccttgggagtctcaaatgttggtgtatggcaccctttctgtactcttatcccatgtttcctactgccttccccaggtttgatatctgggaggtttgatcatccagaggaaattaagtatttttatatcaaattatattacaataaatattacaaatactttctttta

//