ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-07-09 14:59:58, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001420746 817 bp mRNA linear ROD 12-NOV-2024
DEFINITION Mus musculus prostaglandin D2 synthase (brain) (Ptgds), transcript
variant 4, mRNA.
ACCESSION NM_001420746 XM_006497787
VERSION NM_001420746.1
KEYWORDS RefSeq.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 817)
AUTHORS Pezzella-Ferreira,G.N., Pao,C.R.R., Bellas,I., Luna-Gomes,T.,
Muniz,V.S., Paiva,L.A., Amorim,N.R.T., Canetti,C., Bozza,P.T.,
Diaz,B.L. and Bandeira-Melo,C.
TITLE Endogenous PGD2 acting on DP2 receptor counter regulates
Schistosoma mansoni infection-driven hepatic granulomatous fibrosis
JOURNAL PLoS Pathog 20 (8), e1011812 (2024)
PUBMED 39173086
REMARK GeneRIF: Endogenous PGD2 acting on DP2 receptor counter regulates
Schistosoma mansoni infection-driven hepatic granulomatous
fibrosis.
Publication Status: Online-Only
REFERENCE 2 (bases 1 to 817)
AUTHORS Taketomi,Y., Higashi,T., Kano,K., Miki,Y., Mochizuki,C.,
Toyoshima,S., Okayama,Y., Nishito,Y., Nakae,S., Tanaka,S.,
Tokuoka,S.M., Oda,Y., Shichino,S., Ueha,S., Matsushima,K.,
Akahoshi,N., Ishii,S., Chun,J., Aoki,J. and Murakami,M.
TITLE Lipid-orchestrated paracrine circuit coordinates mast cell
maturation and anaphylaxis through functional interaction with
fibroblasts
JOURNAL Immunity 57 (8), 1828-1847 (2024)
PUBMED 39002541
REFERENCE 3 (bases 1 to 817)
AUTHORS Souali-Crespo,S., Condrea,D., Vernet,N., Feret,B., Klopfenstein,M.,
Grandgirard,E., Alunni,V., Cerciat,M., Jung,M., Mayere,C., Nef,S.,
Mark,M., Chalmel,F. and Ghyselinck,N.B.
TITLE Loss of NR5A1 in mouse Sertoli cells after sex determination
changes cellular identity and induces cell death by anoikis
JOURNAL Development 150 (24) (2023)
PUBMED 38078651
REFERENCE 4 (bases 1 to 817)
AUTHORS Horikami,D., Sekihachi,E., Omori,K., Kobayashi,Y., Kobayashi,K.,
Nagata,N., Kurata,K., Uemura,A. and Murata,T.
TITLE Roles of lipocalin-type and hematopoietic prostaglandin D synthases
in mouse retinal angiogenesis
JOURNAL J Lipid Res 64 (10), 100439 (2023)
PUBMED 37666361
REFERENCE 5 (bases 1 to 817)
AUTHORS Qu,F., Li,W., Xu,J., Zhang,R., Ke,J., Ren,X., Meng,X., Qin,L.,
Zhang,J., Lu,F., Zhou,X., Luo,X., Zhang,Z., Wang,M., Wu,G., Pei,D.,
Chen,J., Cui,G., Suo,S. and Peng,G.
TITLE Three-dimensional molecular architecture of mouse organogenesis
JOURNAL Nat Commun 14 (1), 4599 (2023)
PUBMED 37524711
REMARK Publication Status: Online-Only
REFERENCE 6 (bases 1 to 817)
AUTHORS Bingham,C.O. 3rd, Murakami,M., Fujishima,H., Hunt,J.E., Austen,K.F.
and Arm,J.P.
TITLE A heparin-sensitive phospholipase A2 and prostaglandin endoperoxide
synthase-2 are functionally linked in the delayed phase of
prostaglandin D2 generation in mouse bone marrow-derived mast cells
JOURNAL J Biol Chem 271 (42), 25936-25944 (1996)
PUBMED 8824228
REFERENCE 7 (bases 1 to 817)
AUTHORS Pilz,A., Woodward,K., Povey,S. and Abbott,C.
TITLE Comparative mapping of 50 human chromosome 9 loci in the laboratory
mouse
JOURNAL Genomics 25 (1), 139-149 (1995)
PUBMED 7774911
REFERENCE 8 (bases 1 to 817)
AUTHORS Chan,P., Simon-Chazottes,D., Mattei,M.G., Guenet,J.L. and
Salier,J.P.
TITLE Comparative mapping of lipocalin genes in human and mouse: the four
genes for complement C8 gamma chain, prostaglandin-D-synthase,
oncogene-24p3, and progestagen-associated endometrial protein map
to HSA9 and MMU2
JOURNAL Genomics 23 (1), 145-150 (1994)
PUBMED 7829063
REFERENCE 9 (bases 1 to 817)
AUTHORS Igarashi,M., Nagata,A., Toh,H., Urade,Y. and Hayaishi,O.
TITLE Structural organization of the gene for prostaglandin D synthase in
the rat brain
JOURNAL Proc Natl Acad Sci U S A 89 (12), 5376-5380 (1992)
PUBMED 1608945
REFERENCE 10 (bases 1 to 817)
AUTHORS Spies,T. and DeMars,R.
TITLE Restored expression of major histocompatibility class I molecules
by gene transfer of a putative peptide transporter
JOURNAL Nature 351 (6324), 323-324 (1991)
PUBMED 2034277
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AL732557.4.
On May 5, 2023 this sequence version replaced XM_006497787.4.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: SRR5189679.145287.1,
ERR2844019.4683.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN00849381, SAMN01164131
[ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-59 AL732557.4 142783-142841 c
60-234 AL732557.4 142333-142507 c
235-374 AL732557.4 141761-141900 c
375-451 AL732557.4 141606-141682 c
452-568 AL732557.4 140845-140961 c
569-670 AL732557.4 140591-140692 c
671-696 AL732557.4 140093-140118 c
697-817 AL732557.4 139484-139604 c
FEATURES Location/Qualifiers
source 1..817
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6"
/db_xref="taxon:10090"
/chromosome="2"
/map="2 17.28 cM"
gene 1..817
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/note="prostaglandin D2 synthase (brain)"
/db_xref="GeneID:19215"
/db_xref="MGI:MGI:99261"
exon 1..59
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/inference="alignment:Splign:2.1.0"
exon 60..234
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/inference="alignment:Splign:2.1.0"
CDS 121..690
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/EC_number="5.3.99.2"
/note="lipocalin-type prostaglandin-D synthase;
prostaglandin-H2 D-isomerase; glutathione-independent PGD
synthetase; PGD2 synthase; prostaglandin-D2 synthase;
glutathione-independent PGD synthase; prostaglandin D2
synthase (21 kDa, brain)"
/codon_start=1
/product="prostaglandin-H2 D-isomerase precursor"
/protein_id="NP_001407675.1"
/db_xref="GeneID:19215"
/db_xref="MGI:MGI:99261"
/translation="
MAALRMLWMGLVLLGLLGFPQTPAQGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE"
sig_peptide 121..192
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/inference="COORDINATES: ab initio prediction:SignalP:6.0"
mat_peptide 193..687
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/product="Prostaglandin-H2 D-isomerase.
/id=PRO_0000017947"
/note="propagated from UniProtKB/Swiss-Prot (O09114.1)"
misc_feature 193..195
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/note="Pyrrolidone carboxylic acid.
/evidence=ECO:0000250|UniProtKB:P22057; propagated from
UniProtKB/Swiss-Prot (O09114.1);
pyrrolidone-carboxylic-acid site"
misc_feature 208..684
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/note="lipocalin-type prostaglandin D synthase; Region:
lipocalin_L-PGDS; cd19419"
/db_xref="CDD:381194"
misc_feature order(235..237,247..249,253..255,271..276,280..285,
292..297,304..306,310..312,319..321,325..327,349..351,
355..357,361..363,367..369,394..402,406..408,433..435,
439..441,454..456,466..468,472..474,478..480,505..507,
511..513,517..519,553..555,559..561,565..567)
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/note="ligand binding cavity [chemical binding]; other
site"
/db_xref="CDD:381194"
misc_feature 271..273
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000250; propagated from
UniProtKB/Swiss-Prot (O09114.1); glycosylation site"
misc_feature 352..354
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000250; propagated from
UniProtKB/Swiss-Prot (O09114.1); glycosylation site"
exon 235..374
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/inference="alignment:Splign:2.1.0"
exon 375..451
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/inference="alignment:Splign:2.1.0"
exon 452..568
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/inference="alignment:Splign:2.1.0"
exon 569..670
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/inference="alignment:Splign:2.1.0"
exon 671..696
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/inference="alignment:Splign:2.1.0"
exon 697..817
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/inference="alignment:Splign:2.1.0"
regulatory 796..801
/regulatory_class="polyA_signal_sequence"
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/note="hexamer: AATAAA"
polyA_site 817
/gene="Ptgds"
/gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
/note="major polyA site"
ORIGIN
agattttccagcagcagggaagcgccagagtacacacccggcaccatccccactgtgagttttccttgctttgtccacattgctggcatcaggcccaggcacctgctctgctctgagcaaatggctgctcttcgcatgctgtggatgggtttggtcctcctgggtctcttgggattcccacagaccccagcccagggccatgacacagtgcagcccaactttcaacaagacaagttcctggggcgctggtacagcgcgggcctcgcctccaactcaagctggttccgggagaagaaagctgtattgtatatgtgcaagacagtggtagccccctccacagaaggcggcctcaatctcacctctaccttcctcaggaaaaaccagtgtgagaccaagatcatggtactgcagcctgcgggggctcctggacactacacctacagcagcccccactcgggcagcatccactccgtgtcagtggtggaggccaactatgacgagtacgctctgctattcagcagaggcaccaagggcccaggccaggacttccgcatggccaccctctacagcagaacccagactctgaaggacgagctgaaggagaaattcaccacctttagcaaggcccagggcctcacagaggaggacattgttttcctgccccaaccggataagtgcattcaagagtaaacgcaggtgacctggcctcaggactcctttgctctgtcactctcaagatcccagccctggctccccaaagtacctctacaccctccagctttgccttgacaaagaaataaaagtccaaagcaagtca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]