2025-10-14 06:05:10, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001420412 752 bp mRNA linear ROD 29-JUL-2025 DEFINITION Mus musculus midkine (Mdk), transcript variant 7, mRNA. ACCESSION NM_001420412 VERSION NM_001420412.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 752) AUTHORS Guo,J., Zheng,J., Li,R., Yao,J., Zhang,H., Wang,X. and Zhang,C. TITLE Single-cell transcriptome analysis reveals abnormal angiogenesis and placentation by loss of imprinted glutaminyl-peptide cyclotransferase JOURNAL J Zhejiang Univ Sci B 26 (6), 589-608 (2025) PUBMED 40571662 REFERENCE 2 (bases 1 to 752) AUTHORS Zhu,Z., Zou,Q., Wang,C., Li,D., Yang,Y., Xiao,Y., Jin,Y., Yan,J., Luo,L., Sun,Y. and Liang,X. TITLE Isl Identifies the Extraembryonic Mesodermal/Allantois Progenitors and is Required for Placenta Morphogenesis and Vasculature Formation JOURNAL Adv Sci (Weinh) 11 (32), e2400238 (2024) PUBMED 38923264 REFERENCE 3 (bases 1 to 752) AUTHORS Xu,C., Chen,J., Liang,L., Chen,S., Niu,X., Sang,R., Yang,C. and Rong,R. TITLE Midkine promotes renal fibrosis by stabilizing C/EBPbeta to facilitate endothelial-mesenchymal transition JOURNAL Commun Biol 7 (1), 544 (2024) PUBMED 38714800 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 752) AUTHORS Inoh,K., Muramatsu,H., Ochiai,K., Torii,S. and Muramatsu,T. TITLE Midkine, a heparin-binding cytokine, plays key roles in intraperitoneal adhesions JOURNAL Biochem Biophys Res Commun 317 (1), 108-113 (2004) PUBMED 15047154 REFERENCE 5 (bases 1 to 752) AUTHORS Naito,A., Yoshikura,H. and Iwamoto,A. TITLE Similarity of the genomic structure between the two members in a new family of heparin-binding factors JOURNAL Biochem Biophys Res Commun 183 (2), 701-707 (1992) PUBMED 1550576 REFERENCE 6 (bases 1 to 752) AUTHORS Haas,I.G., Simon-Chazottes,D. and Guenet,J.L. TITLE The gene coding for the immunoglobulin heavy chain binding protein BiP (Hsce-70) maps to mouse chromosome 2 JOURNAL Mamm Genome 3 (11), 659-660 (1992) PUBMED 1450517 REFERENCE 7 (bases 1 to 752) AUTHORS Simon-Chazottes,D., Matsubara,S., Miyauchi,T., Muramatsu,T. and Guenet,J.L. TITLE Chromosomal localization of two cell surface-associated molecules of potential importance in development: midkine (Mdk) and basigin (Bsg) JOURNAL Mamm Genome 2 (4), 269-271 (1992) PUBMED 1347477 REFERENCE 8 (bases 1 to 752) AUTHORS Tomomura,M., Kadomatsu,K., Matsubara,S. and Muramatsu,T. TITLE A retinoic acid-responsive gene, MK, found in the teratocarcinoma system. Heterogeneity of the transcript and the nature of the translation product JOURNAL J Biol Chem 265 (18), 10765-10770 (1990) PUBMED 2355021 REFERENCE 9 (bases 1 to 752) AUTHORS Matsubara,S., Tomomura,M., Kadomatsu,K. and Muramatsu,T. TITLE Structure of a retinoic acid-responsive gene, MK, which is transiently activated during the differentiation of embryonal carcinoma cells and the mid-gestation period of mouse embryogenesis JOURNAL J Biol Chem 265 (16), 9441-9443 (1990) PUBMED 2345177 REFERENCE 10 (bases 1 to 752) AUTHORS Kadomatsu,K., Tomomura,M. and Muramatsu,T. TITLE cDNA cloning and sequencing of a new gene intensely expressed in early differentiation stages of embryonal carcinoma cells and in mid-gestation period of mouse embryogenesis JOURNAL Biochem Biophys Res Commun 151 (3), 1312-1318 (1988) PUBMED 3355557 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL731772.9. Summary: This gene encodes a secreted growth factor that belongs to the pleiotrophin/midkine heparin-binding protein family and functions in a variety of biological processes. The encoded cytokine promotes the growth, differentiation, survival and migration of several target cells including leucocytes involved in inflammation. This protein plays a role in the formation of scar tissue and intraperitoneal adhesions, and promotes neurite outgrowth and neuron survival. The protein encoded by this gene is associated with obesity and inhibition of insulin signaling in fat cells. A pseudogene of this gene is present on chromosome 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: SRR15390196.412163.1, SRR17784650.799700.1 [ECO:0000332] RNAseq introns :: partial sample support SAMN00849381, SAMN01164137 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-119 AL731772.9 69238-69356 c 120-278 AL731772.9 68707-68865 c 279-440 AL731772.9 68429-68590 c 441-752 AL731772.9 67415-67726 c FEATURES Location/Qualifiers source 1..752 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="2" /map="2 50.63 cM" gene 1..752 /gene="Mdk" /gene_synonym="Mek; MK" /note="midkine" /db_xref="GeneID:17242" /db_xref="MGI:MGI:96949" exon 1..119 /gene="Mdk" /gene_synonym="Mek; MK" /inference="alignment:Splign:2.1.0" misc_feature 116..118 /gene="Mdk" /gene_synonym="Mek; MK" /note="upstream in-frame stop codon" exon 120..278 /gene="Mdk" /gene_synonym="Mek; MK" /inference="alignment:Splign:2.1.0" CDS 194..466 /gene="Mdk" /gene_synonym="Mek; MK" /note="isoform b is encoded by transcript variant 7; retinoic acid-induced differentiation factor; retinoic acid-responsive protein; retanoic acid-responsive protein" /codon_start=1 /product="midkine isoform b" /protein_id="NP_001407341.1" /db_xref="GeneID:17242" /db_xref="MGI:MGI:96949" /translation="
MGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD"
misc_feature <194..382 /gene="Mdk" /gene_synonym="Mek; MK" /note="PTN/MK heparin-binding protein family, N-terminal domain; Region: PTN_MK_N; cl02505" /db_xref="CDD:470593" exon 279..440 /gene="Mdk" /gene_synonym="Mek; MK" /inference="alignment:Splign:2.1.0" exon 441..752 /gene="Mdk" /gene_synonym="Mek; MK" /inference="alignment:Splign:2.1.0" regulatory 705..710 /regulatory_class="polyA_signal_sequence" /gene="Mdk" /gene_synonym="Mek; MK" /note="hexamer: AATAAA" regulatory 710..715 /regulatory_class="polyA_signal_sequence" /gene="Mdk" /gene_synonym="Mek; MK" /note="hexamer: AATAAA" polyA_site 727 /gene="Mdk" /gene_synonym="Mek; MK" regulatory 729..734 /regulatory_class="polyA_signal_sequence" /gene="Mdk" /gene_synonym="Mek; MK" /note="hexamer: AATAAA" polyA_site 730 /gene="Mdk" /gene_synonym="Mek; MK" /note="major polyA site" polyA_site 752 /gene="Mdk" /gene_synonym="Mek; MK" ORIGIN
cttagcgggacaggccggagcgggagggagcgaagcatcgagcagtgagcgagtgagcgcacgcagtggctgtggccccagtcccttcaggcggctgctctgccaccaagggggctgagagaaggtgaagaagggcagcgagtgttcggagtggacctgggggccctgcacccccagcagcaaggactgcggcatgggcttccgcgagggtacctgtggggcccagacccagcgcgtccattgcaaggtgccctgcaactggaagaaggaatttggagccgactgcaaatacaagtttgagagctggggggcgtgtgatgggagcactggcaccaaagcccgccaagggaccctgaagaaggcgcggtacaatgcccagtgccaggagaccatccgcgtgactaagccctgcacctccaagaccaagtcaaagaccaaagccaagaaaggaaaaggaaaggactaagtcaggaggccagagagcctccggcctcgcctggagcctgaacggagccctcctctcccacaggcccaagatataacccaccagtgccttttgtcttcctgtcagctctgtcaatcacgcctgtcctctcacgcccacaccaagtgcccaaagtggggagggacaagagattctggaaagtgagcctccccataccctcttttgttctccccaccctgatacttgttattaagaaatgaataaaataaactcacttttttccaataaaagcttcttttttaatata
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]