GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-06-18 20:33:31, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       NM_001348246            1237 bp    mRNA    linear   ROD 04-APR-2024
DEFINITION  Mus musculus selenoprotein S (Selenos), transcript variant 2, mRNA.
ACCESSION   NM_001348246
VERSION     NM_001348246.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1237)
  AUTHORS   Qiao,L., Men,L., Yu,S., Yao,J., Li,Y., Wang,M., Yu,Y., Wang,N.,
            Ran,L., Wu,Y. and Du,J.
  TITLE     Hepatic deficiency of selenoprotein S exacerbates hepatic steatosis
            and insulin resistance
  JOURNAL   Cell Death Dis 13 (3), 275 (2022)
   PUBMED   35347118
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1237)
  AUTHORS   Addinsall,A.B., Wright,C.R., Kotsiakos,T.L., Smith,Z.M., Cook,T.R.,
            Andrikopoulos,S., van der Poel,C. and Stupka,N.
  TITLE     Impaired exercise performance is independent of inflammation and
            cellular stress following genetic reduction or deletion of
            selenoprotein S
  JOURNAL   Am J Physiol Regul Integr Comp Physiol 318 (5), R981-R996 (2020)
   PUBMED   32186893
  REMARK    GeneRIF: Impaired exercise performance with Seps1 reduction or
            deletion cannot be attributed to heightened cellular stress or
            inflammation, but it may potentially be mediated, in part, by the
            effects of Seps1 on the microvasculature.
REFERENCE   3  (bases 1 to 1237)
  AUTHORS   Men,L., Yao,J., Yu,S., Li,Y., Cui,S., Jin,S., Zhang,G., Ren,D. and
            Du,J.
  TITLE     Selenoprotein S regulates adipogenesis through IRE1alpha-XBP1
            pathway
  JOURNAL   J Endocrinol 244 (3), 431-443 (2020)
   PUBMED   31846435
  REMARK    GeneRIF: Selenoprotein S regulates adipogenesis through
            IRE1alpha-XBP1 pathway.
REFERENCE   4  (bases 1 to 1237)
  AUTHORS   Men,L., Sun,J. and Ren,D.
  TITLE     Deficiency of VCP-Interacting Membrane Selenoprotein (VIMP) Leads
            to G1 Cell Cycle Arrest and Cell Death in MIN6 Insulinoma Cells
  JOURNAL   Cell Physiol Biochem 51 (5), 2185-2197 (2018)
   PUBMED   30537728
  REMARK    GeneRIF: These results suggest that VIMP may function as a novel
            regulator to modulate beta-cell survival, proliferation, cell
            cycle, unfolded protein response and insulin secretion in MIN6
            cells. VIMP knockdown (KD) decreases cell proliferation and G1 cell
            cycle arrest.
REFERENCE   5  (bases 1 to 1237)
  AUTHORS   Gladyshev,V.N., Arner,E.S., Berry,M.J., Brigelius-Flohe,R.,
            Bruford,E.A., Burk,R.F., Carlson,B.A., Castellano,S., Chavatte,L.,
            Conrad,M., Copeland,P.R., Diamond,A.M., Driscoll,D.M., Ferreiro,A.,
            Flohe,L., Green,F.R., Guigo,R., Handy,D.E., Hatfield,D.L.,
            Hesketh,J., Hoffmann,P.R., Holmgren,A., Hondal,R.J., Howard,M.T.,
            Huang,K., Kim,H.Y., Kim,I.Y., Kohrle,J., Krol,A., Kryukov,G.V.,
            Lee,B.J., Lee,B.C., Lei,X.G., Liu,Q., Lescure,A., Lobanov,A.V.,
            Loscalzo,J., Maiorino,M., Mariotti,M., Sandeep Prabhu,K.,
            Rayman,M.P., Rozovsky,S., Salinas,G., Schmidt,E.E., Schomburg,L.,
            Schweizer,U., Simonovic,M., Sunde,R.A., Tsuji,P.A., Tweedie,S.,
            Ursini,F., Whanger,P.D. and Zhang,Y.
  TITLE     Selenoprotein Gene Nomenclature
  JOURNAL   J Biol Chem 291 (46), 24036-24040 (2016)
   PUBMED   27645994
REFERENCE   6  (bases 1 to 1237)
  AUTHORS   Bubenik,J.L., Miniard,A.C. and Driscoll,D.M.
  TITLE     Alternative transcripts and 3'UTR elements govern the incorporation
            of selenocysteine into selenoprotein S
  JOURNAL   PLoS One 8 (4), e62102 (2013)
   PUBMED   23614019
  REMARK    Publication Status: Online-Only
REFERENCE   7  (bases 1 to 1237)
  AUTHORS   Fradejas,N., Pastor,M.D., Mora-Lee,S., Tranque,P. and Calvo,S.
  TITLE     SEPS1 gene is activated during astrocyte ischemia and shows
            prominent antiapoptotic effects
  JOURNAL   J Mol Neurosci 35 (3), 259-265 (2008)
   PUBMED   18498015
  REMARK    GeneRIF: We found that suppression of SEPS1 by small interfering
            RNA severely increases astrocyte injure caused by OGD, suggesting
            that selenoprotein S protects astrocytes against ischemia.
REFERENCE   8  (bases 1 to 1237)
  AUTHORS   Kim,K.H., Gao,Y., Walder,K., Collier,G.R., Skelton,J. and
            Kissebah,A.H.
  TITLE     SEPS1 protects RAW264.7 cells from pharmacological ER stress
            agent-induced apoptosis
  JOURNAL   Biochem Biophys Res Commun 354 (1), 127-132 (2007)
   PUBMED   17210132
  REMARK    GeneRIF: These findings suggest that SEPS1 could be a new ER
            stress-dependent survival factor that protects macrophage against
            ER stress-induced cellular dysfunction.
REFERENCE   9  (bases 1 to 1237)
  AUTHORS   Curran,J.E., Jowett,J.B., Elliott,K.S., Gao,Y., Gluschenko,K.,
            Wang,J., Abel Azim,D.M., Cai,G., Mahaney,M.C., Comuzzie,A.G.,
            Dyer,T.D., Walder,K.R., Zimmet,P., MacCluer,J.W., Collier,G.R.,
            Kissebah,A.H. and Blangero,J.
  TITLE     Genetic variation in selenoprotein S influences inflammatory
            response
  JOURNAL   Nat Genet 37 (11), 1234-1241 (2005)
   PUBMED   16227999
REFERENCE   10 (bases 1 to 1237)
  AUTHORS   Kryukov,G.V., Castellano,S., Novoselov,S.V., Lobanov,A.V.,
            Zehtab,O., Guigo,R. and Gladyshev,V.N.
  TITLE     Characterization of mammalian selenoproteomes
  JOURNAL   Science 300 (5624), 1439-1443 (2003)
   PUBMED   12775843
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AC124695.4, AK005204.1 and
            AI836862.1.
            
            Summary: This gene encodes a transmembrane protein that is
            localized in the endoplasmic reticulum (ER). It is involved in the
            degradation process of misfolded proteins in the ER, and may also
            have a role in inflammation control. This protein is a
            selenoprotein, containing the rare amino acid selenocysteine (Sec).
            Sec is encoded by the UGA codon, which normally signals translation
            termination. The 3' UTRs of selenoprotein mRNAs contain a conserved
            stem-loop structure, designated the Sec insertion sequence (SECIS)
            element, that is necessary for the recognition of UGA as a Sec
            codon, rather than as a stop signal. Two additional
            phylogenetically conserved stem-loop structures (Stem-loop 1 and
            Stem-loop 2) in the 3' UTR of this mRNA have been shown to function
            as modulators of Sec insertion (PMID:23614019). Alternatively
            spliced transcript variants have been found for this gene.
            [provided by RefSeq, Jul 2017].
            
            Transcript Variant: This variant (2) uses an alternate donor splice
            site at the 5' terminal exon, which results in translation
            initiation from an alternate start codon, compared to variant 1.
            The resulting isoform (2) has a shorter and distinct N-terminus
            compared to isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BU938591.1, BU936537.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849380, SAMN00849381
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            protein contains selenocysteine :: PMID: 12775843
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-170               AC124695.4         43929-44098         c
            171-1104            AK005204.1         125-1058
            1105-1237           AI836862.1         1-133               c
FEATURES             Location/Qualifiers
     source          1..1237
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="7"
                     /map="7 35.49 cM"
     gene            1..1237
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="selenoprotein S"
                     /db_xref="GeneID:109815"
                     /db_xref="MGI:MGI:95994"
     exon            1..170
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    77..79
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="upstream in-frame stop codon"
     CDS             164..667
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="UGA stop codon recoded as selenocysteine; isoform 2
                     is encoded by transcript variant 2; VCP-interacting
                     membrane protein; minor histocompatibility antigen H47"
                     /codon_start=1
                     /transl_except=(pos:659..661,aa:Sec)
                     /product="selenoprotein S isoform 2"
                     /protein_id="NP_001335175.1"
                     /db_xref="GeneID:109815"
                     /db_xref="MGI:MGI:95994"
                     /translation="
MLVGSLLASYGWYILFSCILLYIVIQRLSLRLRALRQRQLDQAETVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKLRQLEEEKRRQKIEMWDSMQEGRSYKRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGGYNPLTGEGGGTCSWRPGRRGPSSGGUN"
     misc_feature    170..658
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:462043"
     misc_feature    659..661
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="Selenocysteine; other site"
     exon            171..305
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /inference="alignment:Splign:2.1.0"
     exon            306..412
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /inference="alignment:Splign:2.1.0"
     exon            413..502
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /inference="alignment:Splign:2.1.0"
     exon            503..581
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /inference="alignment:Splign:2.1.0"
     exon            582..1220
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /inference="alignment:Splign:2.1.0"
     regulatory      670..702
                     /regulatory_class="recoding_stimulatory_region"
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="Stem-loop 1"
                     /function="promotes selenocysteine insertion"
     regulatory      981..1068
                     /regulatory_class="recoding_stimulatory_region"
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="SECIS_element"
                     /function="essential for recoding UGA to specify
                     selenocysteine"
     regulatory      1073..1099
                     /regulatory_class="other"
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="recoding_inhibitory_region; Stem-loop 2"
                     /function="inhibits selenocysteine insertion"
ORIGIN      
gaaccggaagcgcagagcagagaggagcagcgggcttgtcgttggtggcggtggcggtggccgccatggatcgcgatgaggaacctctgtccgcgaggccggcgctggagaccgagagcctgcgattcctgcacgtgacaggtcaggggcggcgggcgccgccatgctcgtgggctccctgctggccagctatggctggtacatcctcttcagctgcatcctactctacattgtcatccagaggctctcccttcgactgagggctttgaggcagagacagctggaccaagccgagactgttctggaacctgatgttgttgttaagcggcaagaggctttagcagctgctcgtttgagaatgcaggaagatctaaatgcccaagttgaaaaacataaggaaaaactaagacagcttgaagaagagaaaagaagacagaagattgaaatgtgggacagcatgcaagaaggcagaagttacaaaagaaattcaggaaggcctcaggaagaagatggtcctggaccttctacttcatctgtcatccccaaaggaaaatctgacaaaaagcctttgcgaggaggtggttataaccctctgacgggtgaagggggtggaacctgctcctggagacctggacgcaggggcccatcatctggcggctgaaactaagactcttgttagtgtcgctctgacattagcaaggtgaacctttaaccctcaactcaattgccttacgcacactttcacagtgactggccaaggagaggtggggcttttctctgttctaaactacttgtactttaagggctttggtcagcatgagatatagacattgccattaggccacactctagacaagacagccatggcttttatggctgctggctagttggtaggttgaaggcttcttgctgtttagcagacttcataaagaaggcccagtgatgatactttggggtagaagtccttgctggcaggatggtctctgtgacgggatgcgttgaatgatgtcttccttataaatggtgaacccaccagtgaggattactgatgttcacagttgacggggtttgcttctgtatatttattttatgtacagaactttgtaaaaaaaaaaaaaagttaaatacttaaaaagtaacatttttagcatctttattaaactcaaggaaatttctttgtgagcttgactttgtcagacagtaaacagctttgtatcattaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]