GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-09-28 11:15:15, GGRNA.v2 : RefSeq release 225 (Jul, 2024)

LOCUS       NM_001347434            1469 bp    mRNA    linear   ROD 05-JUN-2024
DEFINITION  Mus musculus microfibrillar associated protein 5 (Mfap5),
            transcript variant 2, mRNA.
ACCESSION   NM_001347434 XM_006506364
VERSION     NM_001347434.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1469)
  AUTHORS   Chen,Z., Zhao,Q., Chen,L., Gao,S., Meng,L., Liu,Y., Wang,Y., Li,T.
            and Xue,J.
  TITLE     MAGP2 promotes osteogenic differentiation during fracture healing
            through its crosstalk with the beta-catenin pathway
  JOURNAL   J Cell Physiol 239 (4), e31183 (2024)
   PUBMED   38348695
  REMARK    GeneRIF: MAGP2 promotes osteogenic differentiation during fracture
            healing through its crosstalk with the beta-catenin pathway.
REFERENCE   2  (bases 1 to 1469)
  AUTHORS   Jacob,T., Annusver,K., Czarnewski,P., Dalessandri,T., Kalk,C.,
            Levra Levron,C., Campama Sanz,N., Kastriti,M.E., Mikkola,M.L.,
            Rendl,M., Lichtenberger,B.M., Donati,G., Bjorklund,A.K. and
            Kasper,M.
  TITLE     Molecular and spatial landmarks of early mouse skin development
  JOURNAL   Dev Cell 58 (20), 2140-2162 (2023)
   PUBMED   37591247
REFERENCE   3  (bases 1 to 1469)
  AUTHORS   Hofling,C., Rossner,S., Flachmeyer,B., Krueger,M., Hartig,W. and
            Michalski,D.
  TITLE     Tricellulin, alpha-Catenin and Microfibrillar-Associated Protein 5
            Exhibit Concomitantly Altered Immunosignals along with Vascular,
            Extracellular and Cytoskeletal Elements after Experimental Focal
            Cerebral Ischemia
  JOURNAL   Int J Mol Sci 24 (15), 11893 (2023)
   PUBMED   37569268
  REMARK    GeneRIF: Tricellulin, alpha-Catenin and Microfibrillar-Associated
            Protein 5 Exhibit Concomitantly Altered Immunosignals along with
            Vascular, Extracellular and Cytoskeletal Elements after
            Experimental Focal Cerebral Ischemia.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1469)
  AUTHORS   Chen,Z., Zhao,H., Meng,L., Yu,S., Liu,Z. and Xue,J.
  TITLE     Microfibril-Associated Glycoprotein-2 Promoted Fracture Healing via
            Integrin alphavbeta3/PTK2/AKT Signaling
  JOURNAL   Lab Invest 103 (7), 100121 (2023)
   PUBMED   36934797
  REMARK    GeneRIF: Microfibril-Associated Glycoprotein-2 Promoted Fracture
            Healing via Integrin alphavbeta3/PTK2/AKT Signaling.
REFERENCE   5  (bases 1 to 1469)
  AUTHORS   Han,C., Leonardo,T.R., Romana-Souza,B., Shi,J., Keiser,S., Yuan,H.,
            Altakriti,M., Ranzer,M.J., Ferri-Borgogno,S., Mok,S.C., Koh,T.J.,
            Hong,S.J., Chen,L. and DiPietro,L.A.
  TITLE     Microfibril-associated protein 5 and the regulation of skin scar
            formation
  JOURNAL   Sci Rep 13 (1), 8728 (2023)
   PUBMED   37253753
  REMARK    GeneRIF: Microfibril-associated protein 5 and the regulation of
            skin scar formation.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1469)
  AUTHORS   Nehring,L.C., Miyamoto,A., Hein,P.W., Weinmaster,G. and
            Shipley,J.M.
  TITLE     The extracellular matrix protein MAGP-2 interacts with Jagged1 and
            induces its shedding from the cell surface
  JOURNAL   J Biol Chem 280 (21), 20349-20355 (2005)
   PUBMED   15788413
REFERENCE   7  (bases 1 to 1469)
  AUTHORS   Lemaire,R., Farina,G., Kissin,E., Shipley,J.M., Bona,C., Korn,J.H.
            and Lafyatis,R.
  TITLE     Mutant fibrillin 1 from tight skin mice increases extracellular
            matrix incorporation of microfibril-associated glycoprotein 2 and
            type I collagen
  JOURNAL   Arthritis Rheum 50 (3), 915-926 (2004)
   PUBMED   15022335
  REMARK    GeneRIF: Tight skin fibrillin 1 altered extracellular matrix
            organization and caused fibrosis by affecting deposition of MAGP-2
            or other fibrillin-1-associated proteins.
REFERENCE   8  (bases 1 to 1469)
  AUTHORS   Penner,A.S., Rock,M.J., Kielty,C.M. and Shipley,J.M.
  TITLE     Microfibril-associated glycoprotein-2 interacts with fibrillin-1
            and fibrillin-2 suggesting a role for MAGP-2 in elastic fiber
            assembly
  JOURNAL   J Biol Chem 277 (38), 35044-35049 (2002)
   PUBMED   12122015
  REMARK    GeneRIF: interaction with fibrillin-1 and fibrillin-2 suggesting
            role in elastic fiber assembly
REFERENCE   9  (bases 1 to 1469)
  AUTHORS   Shipley,J.M., Mecham,R.P., Maus,E., Bonadio,J., Rosenbloom,J.,
            McCarthy,R.T., Baumann,M.L., Frankfater,C., Segade,F. and
            Shapiro,S.D.
  TITLE     Developmental expression of latent transforming growth factor beta
            binding protein 2 and its requirement early in mouse development
  JOURNAL   Mol Cell Biol 20 (13), 4879-4887 (2000)
   PUBMED   10848613
REFERENCE   10 (bases 1 to 1469)
  AUTHORS   Frankfater,C., Maus,E., Gaal,K., Segade,F., Copeland,N.G.,
            Gilbert,D.J., Jenkins,N.A. and Shipley,J.M.
  TITLE     Organization of the mouse microfibril-associated glycoprotein-2
            (MAGP-2) gene
  JOURNAL   Mamm Genome 11 (3), 191-195 (2000)
   PUBMED   10723723
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC155946.7.
            
            On Nov 26, 2016 this sequence version replaced XM_006506364.3.
            
            Transcript Variant: This variant (2) lacks an alternate in-frame
            exon in the 5' coding region compared to variant 1. It encodes
            isoform 2 which is shorter compared to isoform 1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DV061445.1, ERR3835353.125048.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849375
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-149               AC155946.7         121370-121518
            150-209             AC155946.7         122127-122186
            210-245             AC155946.7         123134-123169
            246-278             AC155946.7         128365-128397
            279-311             AC155946.7         128682-128714
            312-335             AC155946.7         132273-132296
            336-423             AC155946.7         133737-133824
            424-497             AC155946.7         134573-134646
            498-1469            AC155946.7         136105-137076
FEATURES             Location/Qualifiers
     source          1..1469
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="6"
                     /map="6 57.61 cM"
     gene            1..1469
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
                     /note="microfibrillar associated protein 5"
                     /db_xref="GeneID:50530"
                     /db_xref="MGI:MGI:1354387"
     exon            1..149
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    86..88
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
                     /note="upstream in-frame stop codon"
     exon            150..209
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
                     /inference="alignment:Splign:2.1.0"
     CDS             152..610
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
                     /note="isoform 2 precursor is encoded by transcript
                     variant 2; microfibril-associated glycoprotein 2"
                     /codon_start=1
                     /product="microfibrillar-associated protein 5 isoform 2
                     precursor"
                     /protein_id="NP_001334363.1"
                     /db_xref="CCDS:CCDS85155.1"
                     /db_xref="GeneID:50530"
                     /db_xref="MGI:MGI:1354387"
                     /translation="
MLFLGQKALLLVLAISIPSDWLPLGVSGQRGDDVPETFTDDPNLVNDPSTDDTAGDKNATAECRDEKFACTRLYSVHRPVRQCVHQSCFTSLRRMYIINNEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENMNLQRPDGL"
     sig_peptide     152..235
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
     misc_feature    155..517
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
                     /note="Microfibril-associated glycoprotein (MAGP); Region:
                     MAGP; pfam05507"
                     /db_xref="CDD:461667"
     exon            210..245
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
                     /inference="alignment:Splign:2.1.0"
     exon            246..278
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
                     /inference="alignment:Splign:2.1.0"
     exon            279..311
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
                     /inference="alignment:Splign:2.1.0"
     exon            312..335
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
                     /inference="alignment:Splign:2.1.0"
     exon            336..423
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
                     /inference="alignment:Splign:2.1.0"
     exon            424..497
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
                     /inference="alignment:Splign:2.1.0"
     exon            498..1469
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
                     /inference="alignment:Splign:2.1.0"
     regulatory      792..797
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
                     /note="hexamer: AATACA"
     polyA_site      814
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
                     /note="major polyA site"
     regulatory      1443..1448
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
                     /note="hexamer: AATAAA"
     polyA_site      1469
                     /gene="Mfap5"
                     /gene_synonym="MAGP-2; MFAP-5"
ORIGIN      
ttagaataggccaaatgtgaagtctttccaagggtgtggctgtgttcatcttattctccagcccaagtagaacagcagagaagcgtgagaaggacggacacactcagcagccagaggccaccggcagacagatcgcagctctgtagacaatatgctgttcttggggcagaaggccttgctgcttgtcttggcaatcagcatcccctctgactggctacccctaggggtcagtggtcaacgcggagatgatgtgcctgagacattcacagacgaccctaatctggtgaacgatccctctacagacgatacagctggtgacaaaaatgctactgcagagtgccgggatgagaagtttgcttgtacaagactgtactctgtccatcggccagtcagacagtgtgtgcaccagtcctgcttcaccagtttacggcgcatgtacatcatcaataatgagatctgttcccgactcgtctgtaaagaacatgaagctatgaaagatgagctttgccggcagatggcaggcctgcctccaaggcgacttcggcgctccaactacttccgacttcctccctgtgaaaatatgaatttgcagagacccgatggtctgtgatcaccaaggaagaaagaagaaaatgtggatgaaggaatcgaaaattctttctcctccaacccctgccatctgtcccgtagacatgtatttttaaactaagccctttgcaatgccccggcttcctaccctactctaattttcactggtgctggtaacgtttgtctcattttgcggtactgacaatacattgtctatattgtggcacgggtttgctgatttctggtgttgtagacaagatggataaaggatggccacttgacttagatacattcagctacattcagctcctgcagtagaaaggggctggggtgcgtggctcagttggcagaaaacttacctaacctttaggttaatattttttttaaatggtgctatgaattgatctcagagcctcgtatataatagtcaatgctctatcactaagctatacccctatctcctaagtagataattttaattattaaatatgccagagacaggagcttgccagaggctcgagccacagagcttccttctagaagtttcctaggttaactcctcattgtttacatatcctctgtactcactttcaccatgcttcgtggcttgtcctaaattttgcccagcaagtcttcatgatgggaaggttgtgggtgaggcaagagagatggctcaatggttaagaacactggatgttcttccagaggacctgggttcagttcccagccagcatccacatggtggctcacaatcacccataagtctagttccagaggacctgagatattttctggcatccatgggcactgcatgcatatgtcacacagacatacatgtggaaaacacacataaaaataaatcactttttaaaaggcaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]