GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-09-28 11:20:15, GGRNA.v2 : RefSeq release 225 (Jul, 2024)

LOCUS       NM_001310503             832 bp    mRNA    linear   ROD 07-AUG-2023
DEFINITION  Mus musculus reproductive homeobox 2A (Rhox2a), transcript variant
            2, mRNA.
ACCESSION   NM_001310503 XM_006541405
VERSION     NM_001310503.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 832)
  AUTHORS   Branco MR, King M, Perez-Garcia V, Bogutz AB, Caley M, Fineberg E,
            Lefebvre L, Cook SJ, Dean W, Hemberger M and Reik W.
  TITLE     Maternal DNA Methylation Regulates Early Trophoblast Development
  JOURNAL   Dev Cell 36 (2), 152-163 (2016)
   PUBMED   26812015
REFERENCE   2  (bases 1 to 832)
  AUTHORS   Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ,
            Harley VR, Koopman P and Sinclair AH.
  TITLE     The rhox homeobox gene family shows sexually dimorphic and dynamic
            expression during mouse embryonic gonad development
  JOURNAL   Biol Reprod 79 (3), 468-474 (2008)
   PUBMED   18562707
REFERENCE   3  (bases 1 to 832)
  AUTHORS   Hu Z, Shanker S, MacLean JA 2nd, Ackerman SL and Wilkinson MF.
  TITLE     The RHOX5 homeodomain protein mediates transcriptional repression
            of the netrin-1 receptor gene Unc5c
  JOURNAL   J Biol Chem 283 (7), 3866-3876 (2008)
   PUBMED   18077458
REFERENCE   4  (bases 1 to 832)
  AUTHORS   Oda M, Yamagiwa A, Yamamoto S, Nakayama T, Tsumura A, Sasaki H,
            Nakao K, Li E and Okano M.
  TITLE     DNA methylation regulates long-range gene silencing of an X-linked
            homeobox gene cluster in a lineage-specific manner
  JOURNAL   Genes Dev 20 (24), 3382-3394 (2006)
   PUBMED   17182866
REFERENCE   5  (bases 1 to 832)
  AUTHORS   MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and
            Wilkinson,M.F.
  TITLE     Rhox homeobox gene cluster: recent duplication of three family
            members
  JOURNAL   Genesis 44 (3), 122-129 (2006)
   PUBMED   16496311
REFERENCE   6  (bases 1 to 832)
  AUTHORS   Morris L, Gordon J and Blackburn CC.
  TITLE     Identification of a tandem duplicated array in the Rhox alpha locus
            on mouse chromosome X
  JOURNAL   Mamm Genome 17 (2), 178-187 (2006)
   PUBMED   16465597
REFERENCE   7  (bases 1 to 832)
  AUTHORS   Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML,
            Macleod C and Wilkinson MF.
  TITLE     Rhox: a new homeobox gene cluster
  JOURNAL   Cell 120 (3), 369-382 (2005)
   PUBMED   15707895
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AK015997.1, AL451076.14 and BX637526.1.
            
            On Jul 15, 2015 this sequence version replaced XM_006541405.2.
            
            Transcript Variant: This variant (2) contains an alternate exon,
            which results in a frameshift, compared to variant 1. The resulting
            protein (isoform 2) has a distinct C-terminus, compared to isoform
            1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC145534.1, SRR5189685.255386.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164134, SAMN01164142
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-553               AK015997.1         2-554
            554-602             AL451076.14        174039-174087
            603-828             AK015997.1         555-780
            829-832             BX637526.1         4-7                 c
FEATURES             Location/Qualifiers
     source          1..832
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 21.67 cM"
     gene            1..832
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /note="reproductive homeobox 2A"
                     /db_xref="GeneID:75199"
                     /db_xref="MGI:MGI:1922449"
     exon            1..95
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /inference="alignment:Splign:2.1.0"
     CDS             29..580
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /note="isoform 2 is encoded by transcript variant 2;
                     reproductive homeobox on X chromosome, 2"
                     /codon_start=1
                     /product="reproductive homeobox 2A isoform 2"
                     /protein_id="NP_001297432.1"
                     /db_xref="CCDS:CCDS81118.1"
                     /db_xref="GeneID:75199"
                     /db_xref="MGI:MGI:1922449"
                     /translation="
MERQSVNYKLDVGPEEDEENANGVKTLMVLLAGEGRNEGESGRGLPGSGASAAEGYRAGEISAGGPAAPVADLMDNSNQEDLGATGCDQEKEKQPEEPVPDSMGDLENVKRVSGPWSTVNPVRVLVPEFRHGWQQSFNVLQLQELESIFQCNHYISTKEANRLARSMGVSEATVQVDKSNRKE"
     misc_feature    428..571
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     exon            96..507
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /inference="alignment:Splign:2.1.0"
     exon            508..553
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /inference="alignment:Splign:2.1.0"
     exon            554..602
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /inference="alignment:Splign:2.1.0"
     exon            603..832
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gaataaggacttccacggctttacagacatggagcgacaaagcgtcaattacaagcttgatgtgggacctgaggaggatgaggaaaatgcgaatggtgtaaagactctgatggtcttgctggctggagagggaagaaatgagggagagagtggacggggcctgcctgggtcgggagcctcagcagcggaaggatacagagcaggagaaataagtgcaggtgggcctgctgcgccagtagccgacctcatggataacagcaaccaagaggaccttggtgccactggctgtgaccaggagaaggagaagcagccagaggagccagtccctgattccatgggagatttggaaaatgtaaagcgtgtgtccgggccgtggtccactgttaatcctgtgagagtgttggtgcccgaattccgccacggttggcaacagagcttcaatgtgctgcaactacaagagctggagagcatcttccagtgcaatcactacatcagcactaaggaggcaaatcgcctggcaagatccatgggagtgagtgaagccacagtgcaggtggacaaatcaaacagaaaggaataagagtgtataatgttacatacatgaatggtttttgaagaggagagagaaatacaggagttataagaggctgtaaaggctcagaggtcctcttcctgcattccggagcatctctctgtgaaggctgtggagaagccccaggcagccacccatgctcaagtcactgtagacagacgatgttgtgccgccaaagccctgttacaacacagttatctcctcaatacttgtatttgcaataaagagctgaattctcaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]