2024-09-28 11:20:15, GGRNA.v2 : RefSeq release 225 (Jul, 2024)
LOCUS NM_001310503 832 bp mRNA linear ROD 07-AUG-2023 DEFINITION Mus musculus reproductive homeobox 2A (Rhox2a), transcript variant 2, mRNA. ACCESSION NM_001310503 XM_006541405 VERSION NM_001310503.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 832) AUTHORS Branco MR, King M, Perez-Garcia V, Bogutz AB, Caley M, Fineberg E, Lefebvre L, Cook SJ, Dean W, Hemberger M and Reik W. TITLE Maternal DNA Methylation Regulates Early Trophoblast Development JOURNAL Dev Cell 36 (2), 152-163 (2016) PUBMED 26812015 REFERENCE 2 (bases 1 to 832) AUTHORS Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ, Harley VR, Koopman P and Sinclair AH. TITLE The rhox homeobox gene family shows sexually dimorphic and dynamic expression during mouse embryonic gonad development JOURNAL Biol Reprod 79 (3), 468-474 (2008) PUBMED 18562707 REFERENCE 3 (bases 1 to 832) AUTHORS Hu Z, Shanker S, MacLean JA 2nd, Ackerman SL and Wilkinson MF. TITLE The RHOX5 homeodomain protein mediates transcriptional repression of the netrin-1 receptor gene Unc5c JOURNAL J Biol Chem 283 (7), 3866-3876 (2008) PUBMED 18077458 REFERENCE 4 (bases 1 to 832) AUTHORS Oda M, Yamagiwa A, Yamamoto S, Nakayama T, Tsumura A, Sasaki H, Nakao K, Li E and Okano M. TITLE DNA methylation regulates long-range gene silencing of an X-linked homeobox gene cluster in a lineage-specific manner JOURNAL Genes Dev 20 (24), 3382-3394 (2006) PUBMED 17182866 REFERENCE 5 (bases 1 to 832) AUTHORS MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and Wilkinson,M.F. TITLE Rhox homeobox gene cluster: recent duplication of three family members JOURNAL Genesis 44 (3), 122-129 (2006) PUBMED 16496311 REFERENCE 6 (bases 1 to 832) AUTHORS Morris L, Gordon J and Blackburn CC. TITLE Identification of a tandem duplicated array in the Rhox alpha locus on mouse chromosome X JOURNAL Mamm Genome 17 (2), 178-187 (2006) PUBMED 16465597 REFERENCE 7 (bases 1 to 832) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK015997.1, AL451076.14 and BX637526.1. On Jul 15, 2015 this sequence version replaced XM_006541405.2. Transcript Variant: This variant (2) contains an alternate exon, which results in a frameshift, compared to variant 1. The resulting protein (isoform 2) has a distinct C-terminus, compared to isoform 1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: BC145534.1, SRR5189685.255386.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164134, SAMN01164142 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-553 AK015997.1 2-554 554-602 AL451076.14 174039-174087 603-828 AK015997.1 555-780 829-832 BX637526.1 4-7 c FEATURES Location/Qualifiers source 1..832 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 21.67 cM" gene 1..832 /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /note="reproductive homeobox 2A" /db_xref="GeneID:75199" /db_xref="MGI:MGI:1922449" exon 1..95 /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /inference="alignment:Splign:2.1.0" CDS 29..580 /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /note="isoform 2 is encoded by transcript variant 2; reproductive homeobox on X chromosome, 2" /codon_start=1 /product="reproductive homeobox 2A isoform 2" /protein_id="NP_001297432.1" /db_xref="CCDS:CCDS81118.1" /db_xref="GeneID:75199" /db_xref="MGI:MGI:1922449" /translation="
MERQSVNYKLDVGPEEDEENANGVKTLMVLLAGEGRNEGESGRGLPGSGASAAEGYRAGEISAGGPAAPVADLMDNSNQEDLGATGCDQEKEKQPEEPVPDSMGDLENVKRVSGPWSTVNPVRVLVPEFRHGWQQSFNVLQLQELESIFQCNHYISTKEANRLARSMGVSEATVQVDKSNRKE"
misc_feature 428..571 /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" exon 96..507 /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /inference="alignment:Splign:2.1.0" exon 508..553 /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /inference="alignment:Splign:2.1.0" exon 554..602 /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /inference="alignment:Splign:2.1.0" exon 603..832 /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /inference="alignment:Splign:2.1.0" ORIGIN
gaataaggacttccacggctttacagacatggagcgacaaagcgtcaattacaagcttgatgtgggacctgaggaggatgaggaaaatgcgaatggtgtaaagactctgatggtcttgctggctggagagggaagaaatgagggagagagtggacggggcctgcctgggtcgggagcctcagcagcggaaggatacagagcaggagaaataagtgcaggtgggcctgctgcgccagtagccgacctcatggataacagcaaccaagaggaccttggtgccactggctgtgaccaggagaaggagaagcagccagaggagccagtccctgattccatgggagatttggaaaatgtaaagcgtgtgtccgggccgtggtccactgttaatcctgtgagagtgttggtgcccgaattccgccacggttggcaacagagcttcaatgtgctgcaactacaagagctggagagcatcttccagtgcaatcactacatcagcactaaggaggcaaatcgcctggcaagatccatgggagtgagtgaagccacagtgcaggtggacaaatcaaacagaaaggaataagagtgtataatgttacatacatgaatggtttttgaagaggagagagaaatacaggagttataagaggctgtaaaggctcagaggtcctcttcctgcattccggagcatctctctgtgaaggctgtggagaagccccaggcagccacccatgctcaagtcactgtagacagacgatgttgtgccgccaaagccctgttacaacacagttatctcctcaatacttgtatttgcaataaagagctgaattctcaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]