GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-07-07 07:52:46, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001306217            1189 bp    mRNA    linear   ROD 23-JUN-2025
DEFINITION  Mus musculus trafficking protein particle complex 6B (Trappc6b),
            transcript variant 2, mRNA.
ACCESSION   NM_001306217
VERSION     NM_001306217.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1189)
  AUTHORS   Kim,J.J., Lipatova,Z. and Segev,N.
  TITLE     TRAPP Complexes in Secretion and Autophagy
  JOURNAL   Front Cell Dev Biol 4, 20 (2016)
   PUBMED   27066478
  REMARK    Review article
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1189)
  AUTHORS   Pan,J., Mor,G., Ju,W., Zhong,J., Luo,X., Aldo,P.B., Zhong,M.,
            Yu,Y., Jenkins,E.C., Brown,W.T. and Zhong,N.
  TITLE     Viral Infection-Induced Differential Expression of LncRNAs
            Associated with Collagen in Mouse Placentas and Amniotic Sacs
  JOURNAL   Am J Reprod Immunol 74 (3), 237-257 (2015)
   PUBMED   26073538
REFERENCE   3  (bases 1 to 1189)
  AUTHORS   Hughes,D.S., Keynes,R.J. and Tannahill,D.
  TITLE     Extensive molecular differences between anterior- and
            posterior-half-sclerotomes underlie somite polarity and spinal
            nerve segmentation
  JOURNAL   BMC Dev Biol 9, 30 (2009)
   PUBMED   19463158
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1189)
  AUTHORS   Evsikov,A.V., Graber,J.H., Brockman,J.M., Hampl,A., Holbrook,A.E.,
            Singh,P., Eppig,J.J., Solter,D. and Knowles,B.B.
  TITLE     Cracking the egg: molecular dynamics and evolutionary aspects of
            the transition from the fully grown oocyte to embryo
  JOURNAL   Genes Dev 20 (19), 2713-2727 (2006)
   PUBMED   17015433
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DV660612.1, AK020026.1 and CO039101.1.
            
            Transcript Variant: This variant (2) lacks an alternate exon in the
            3' coding region, resulting in a frameshift, compared to variant 1.
            The encoded isoform (2) is shorter and has a distinct C-terminus
            compared to isoform 1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BI083113.1, BI080002.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849381, SAMN00849384
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-68                DV660612.1         16-83
            69-587              AK020026.1         38-556
            588-982             AK020026.1         651-1045
            983-1189            CO039101.1         1-207               c
FEATURES             Location/Qualifiers
     source          1..1189
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="12"
                     /map="12 25.99 cM"
     gene            1..1189
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /note="trafficking protein particle complex 6B"
                     /db_xref="GeneID:78232"
                     /db_xref="MGI:MGI:1925482"
     exon            1..317
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    198..200
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /note="upstream in-frame stop codon"
     CDS             237..602
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /note="isoform 2 is encoded by transcript variant 2;
                     trafficking protein particle complex subunit 6B; TRAPP
                     complex subunit 6B"
                     /codon_start=1
                     /product="trafficking protein particle complex subunit 6B
                     isoform 2"
                     /protein_id="NP_001293146.1"
                     /db_xref="CCDS:CCDS88340.1"
                     /db_xref="GeneID:78232"
                     /db_xref="MGI:MGI:1925482"
                     /translation="
MADEALFLLLHNEMVSGVYKSAEQGEVENGRCVTKLESMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLIQLSAGKQYLEHASKANFR"
     misc_feature    243..>587
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /note="Trs33 subunit of the TRAPP complex; Region:
                     TRAPPC6A_Trs33; cd14944"
                     /db_xref="CDD:271347"
     misc_feature    order(249..251,258..260,270..272,543..548,576..578)
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /note="synbindin interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:271347"
     misc_feature    order(252..257,261..269,273..278,285..287,339..341,
                     351..353,360..365,372..377,384..386,459..461,468..470,
                     528..530)
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /note="BET3 interface [polypeptide binding]; other site"
                     /db_xref="CDD:271347"
     exon            318..385
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            386..503
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            504..587
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            588..1172
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1113..1118
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /note="hexamer: AATACA"
     polyA_site      1134
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /note="major polyA site"
ORIGIN      
ggaagtggctcaggctccacgcccagcgctatagtcttggcagagtgtggggctgtcacagggtctctagggcccagtggcggcggccccggggaggggcgcggtccacggcggccttccgcggccttaggacccgggtaggccgctgagcacggcgtgcggtgggcgcggggtaacgggaacctcgagtcccgcactgatcggagccgactcggcgctggagggatcggcgggaaatggcggacgaggcgttgtttttgcttctccataacgagatggtgtccggagtgtacaagtccgccgagcagggggaagtggaaaatggaaggtgtgttactaagctggagagcatggggttccgagtggggcaaggactgatagaaaggtttacgaaagatactgcaaggttcaaggatgaattagacatcatgaagttcatctgtaaagatttttggactacagtattcaagaaacagattgacaatctgaggacaaatcatcagggcatatatgtacttcaggacaacaaatttcgactactcattcagctgtctgcaggaaaacagtatttagaacatgcgtccaaggcaaatttcaggtgatgatacagaagctgtagagcgagctggcgactcctgggcagagcgttgcacatcctgatttcacctcatcgttggttatctgcgttggagcaaatcgttatctcaccagagtcacatagaccaaatcaaagtagacacaggtcctttgaccatgacagaaactgactgacctattcagtgatttcagagaactagacaccaagatgcaaggctcttcattttaaacatctttatttccataggtgattagcatttaaccatcaataggaagtgaaactcagggtgtgttgaattgctgtattaaaaaaaatgcaccaatcagaatagtttgtgttcaaatgaccaaaatttgttgaactataaatctgttttagttatttaaaaaagcaaaccactatgttaaattaagcttaatttttattgtattgcttataatttatttctgtcgagagaattcatatgcttatgtaaggatatcatttatacattgtgtatatatgtgtatatataaatacatgcattactgtctaaattacttgaaagtttattttaatagacttgagtccttgaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]