GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-23 09:26:06, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001289587             683 bp    mRNA    linear   ROD 28-APR-2025
DEFINITION  Mus musculus glycosylation dependent cell adhesion molecule 1
            (Glycam1), transcript variant 1, mRNA.
ACCESSION   NM_001289587
VERSION     NM_001289587.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 683)
  AUTHORS   Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
            Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
            Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
            Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
            Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
            Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
            Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
            Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
            Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
            Jackson,S.P. and Balmus,G.
  CONSRTM   Sanger Mouse Genetics Project
  TITLE     Genetic determinants of micronucleus formation in vivo
  JOURNAL   Nature 627 (8002), 130-136 (2024)
   PUBMED   38355793
REFERENCE   2  (bases 1 to 683)
  AUTHORS   Dill-Garlow,R., Chen,K.E. and Walker,A.M.
  TITLE     Sex Differences in Mouse Popliteal Lymph Nodes
  JOURNAL   Sci Rep 9 (1), 965 (2019)
   PUBMED   30700819
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 683)
  AUTHORS   Sundberg,J.P., Dadras,S.S., Silva,K.A., Kennedy,V.E., Garland,G.,
            Murray,S.A., Sundberg,B.A., Schofield,P.N. and Pratt,C.H.
  TITLE     Systematic screening for skin, hair, and nail abnormalities in a
            large-scale knockout mouse program
  JOURNAL   PLoS One 12 (7), e0180682 (2017)
   PUBMED   28700664
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 683)
  AUTHORS   Williams,P.A., Braine,C.E., Foxworth,N.E., Cochran,K.E. and
            John,S.W.M.
  TITLE     GlyCAM1 negatively regulates monocyte entry into the optic nerve
            head and contributes to radiation-based protection in glaucoma
  JOURNAL   J Neuroinflammation 14 (1), 93 (2017)
   PUBMED   28446179
  REMARK    GeneRIF: GlyCam1 levels modulate immune cell entry from the
            vasculature into neural tissues.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 683)
  AUTHORS   Dickinson,M.E., Flenniken,A.M., Ji,X., Teboul,L., Wong,M.D.,
            White,J.K., Meehan,T.F., Weninger,W.J., Westerberg,H., Adissu,H.,
            Baker,C.N., Bower,L., Brown,J.M., Caddle,L.B., Chiani,F., Clary,D.,
            Cleak,J., Daly,M.J., Denegre,J.M., Doe,B., Dolan,M.E., Edie,S.M.,
            Fuchs,H., Gailus-Durner,V., Galli,A., Gambadoro,A., Gallegos,J.,
            Guo,S., Horner,N.R., Hsu,C.W., Johnson,S.J., Kalaga,S., Keith,L.C.,
            Lanoue,L., Lawson,T.N., Lek,M., Mark,M., Marschall,S., Mason,J.,
            McElwee,M.L., Newbigging,S., Nutter,L.M., Peterson,K.A.,
            Ramirez-Solis,R., Rowland,D.J., Ryder,E., Samocha,K.E.,
            Seavitt,J.R., Selloum,M., Szoke-Kovacs,Z., Tamura,M., Trainor,A.G.,
            Tudose,I., Wakana,S., Warren,J., Wendling,O., West,D.B., Wong,L.,
            Yoshiki,A., MacArthur,D.G., Tocchini-Valentini,G.P., Gao,X.,
            Flicek,P., Bradley,A., Skarnes,W.C., Justice,M.J., Parkinson,H.E.,
            Moore,M., Wells,S., Braun,R.E., Svenson,K.L., de Angelis,M.H.,
            Herault,Y., Mohun,T., Mallon,A.M., Henkelman,R.M., Brown,S.D.,
            Adams,D.J., Lloyd,K.C., McKerlie,C., Beaudet,A.L., Bucan,M. and
            Murray,S.A.
  CONSRTM   International Mouse Phenotyping Consortium; Jackson Laboratory;
            Infrastructure Nationale PHENOMIN, Institut Clinique de la Souris
            (ICS); Charles River Laboratories; MRC Harwell; Toronto Centre for
            Phenogenomics; Wellcome Trust Sanger Institute; RIKEN BioResource
            Center
  TITLE     High-throughput discovery of novel developmental phenotypes
  JOURNAL   Nature 537 (7621), 508-514 (2016)
   PUBMED   27626380
  REMARK    Erratum:[Nature. 2017 Nov 16;551(7680):398. doi:
            10.1038/nature24643. PMID: 29144450]
REFERENCE   6  (bases 1 to 683)
  AUTHORS   Hemmerich,S., Leffler,H. and Rosen,S.D.
  TITLE     Structure of the O-glycans in GlyCAM-1, an endothelial-derived
            ligand for L-selectin
  JOURNAL   J Biol Chem 270 (20), 12035-12047 (1995)
   PUBMED   7538131
REFERENCE   7  (bases 1 to 683)
  AUTHORS   Hemmerich,S., Bertozzi,C.R., Leffler,H. and Rosen,S.D.
  TITLE     Identification of the sulfated monosaccharides of GlyCAM-1, an
            endothelial-derived ligand for L-selectin
  JOURNAL   Biochemistry 33 (16), 4820-4829 (1994)
   PUBMED   7512827
REFERENCE   8  (bases 1 to 683)
  AUTHORS   Lasky,L.A., Singer,M.S., Dowbenko,D., Imai,Y., Henzel,W.J.,
            Grimley,C., Fennie,C., Gillett,N., Watson,S.R. and Rosen,S.D.
  TITLE     An endothelial ligand for L-selectin is a novel mucin-like molecule
  JOURNAL   Cell 69 (6), 927-938 (1992)
   PUBMED   1376638
REFERENCE   9  (bases 1 to 683)
  AUTHORS   Kawamura,K., Satow,H., Do Ik,L., Sakai,S., Takada,S. and Obinata,M.
  TITLE     Modulation of the transferred mouse 26K casein gene in mouse L
            cells by glucocorticoid hormone
  JOURNAL   J Biochem 101 (1), 103-110 (1987)
   PUBMED   3571195
REFERENCE   10 (bases 1 to 683)
  AUTHORS   Satow,H., Sakai,S. and Obinata,M.
  TITLE     Post-transcriptional control of 26 k casein genes during
            lactogenesis in mouse mammary glands
  JOURNAL   J Biochem 99 (6), 1639-1643 (1986)
   PUBMED   3745138
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC108858.16 and BE947771.1.
            
            Transcript Variant: This variant (1) represents the longer
            transcript and encodes the longer isoform (1).
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AW212743.1, BF122403.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849375 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-114               AC108858.16        93487-93600
            115-159             AC108858.16        94327-94371
            160-413             AC108858.16        95110-95363
            414-502             AC108858.16        95554-95642
            503-683             BE947771.1         1-181               c
FEATURES             Location/Qualifiers
     source          1..683
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="15"
                     /map="15 59.03 cM"
     gene            1..683
                     /gene="Glycam1"
                     /gene_synonym="glyCAM-1; MC26; Sgp50"
                     /note="glycosylation dependent cell adhesion molecule 1"
                     /db_xref="GeneID:14663"
                     /db_xref="MGI:MGI:95759"
     exon            1..114
                     /gene="Glycam1"
                     /gene_synonym="glyCAM-1; MC26; Sgp50"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    30..32
                     /gene="Glycam1"
                     /gene_synonym="glyCAM-1; MC26; Sgp50"
                     /note="upstream in-frame stop codon"
     CDS             51..437
                     /gene="Glycam1"
                     /gene_synonym="glyCAM-1; MC26; Sgp50"
                     /note="isoform 1 precursor is encoded by transcript
                     variant 1; sulfated 50 kDa glycoprotein; endothelial
                     ligand FOR L-selectin; Sele ligand; GlyCAM 1;
                     Glycosylation-dependent cell adhesion molecule 1"
                     /codon_start=1
                     /product="glycosylation-dependent cell adhesion molecule 1
                     isoform 1 precursor"
                     /protein_id="NP_001276516.1"
                     /db_xref="CCDS:CCDS88862.1"
                     /db_xref="GeneID:14663"
                     /db_xref="MGI:MGI:95759"
                     /translation="
MKFFTVLLFVSLAATSLALLPGSKDELQMKTQPTDAIPAAQSTPTSYTSEESTSSKDLSKEPSIFREELISKDNVVIESTKPENQEAQDGLRSGSSQLEETTRPTTSAGMSQGRRKMSWEVQPPQRKI"
     sig_peptide     51..107
                     /gene="Glycam1"
                     /gene_synonym="glyCAM-1; MC26; Sgp50"
                     /note="/evidence=ECO:0000269|PubMed:1376638; propagated
                     from UniProtKB/Swiss-Prot (Q02596.1)"
     misc_feature    108..>374
                     /gene="Glycam1"
                     /gene_synonym="glyCAM-1; MC26; Sgp50"
                     /note="Glycosylation-dependent cell adhesion molecule 1
                     (GlyCAM-1); Region: GLYCAM-1; pfam05242"
                     /db_xref="CDD:368355"
     misc_feature    210..212
                     /gene="Glycam1"
                     /gene_synonym="glyCAM-1; MC26; Sgp50"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P80195; propagated from
                     UniProtKB/Swiss-Prot (Q02596.1); phosphorylation site"
     misc_feature    225..227
                     /gene="Glycam1"
                     /gene_synonym="glyCAM-1; MC26; Sgp50"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P80195; propagated from
                     UniProtKB/Swiss-Prot (Q02596.1); phosphorylation site"
     misc_feature    237..239
                     /gene="Glycam1"
                     /gene_synonym="glyCAM-1; MC26; Sgp50"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P80195; propagated from
                     UniProtKB/Swiss-Prot (Q02596.1); phosphorylation site"
     misc_feature    261..263
                     /gene="Glycam1"
                     /gene_synonym="glyCAM-1; MC26; Sgp50"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P80195; propagated from
                     UniProtKB/Swiss-Prot (Q02596.1); phosphorylation site"
     exon            115..159
                     /gene="Glycam1"
                     /gene_synonym="glyCAM-1; MC26; Sgp50"
                     /inference="alignment:Splign:2.1.0"
     exon            160..413
                     /gene="Glycam1"
                     /gene_synonym="glyCAM-1; MC26; Sgp50"
                     /inference="alignment:Splign:2.1.0"
     exon            414..669
                     /gene="Glycam1"
                     /gene_synonym="glyCAM-1; MC26; Sgp50"
                     /inference="alignment:Splign:2.1.0"
     regulatory      649..654
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Glycam1"
                     /gene_synonym="glyCAM-1; MC26; Sgp50"
                     /note="hexamer: ATTAAA"
     polyA_site      669
                     /gene="Glycam1"
                     /gene_synonym="glyCAM-1; MC26; Sgp50"
                     /note="major polyA site"
ORIGIN      
agcattctactctgcttcccagggaaagctgaccttgttccagtgccaccatgaaattcttcactgtcctgctatttgtcagtcttgctgccacctctcttgctctcctgcctgggtccaaagatgaacttcaaatgaagactcagcccacagatgccattccagctgcccagtccactcccaccagctacaccagtgaggagagtacttccagtaaggacctttccaaggagccttccatcttcagagaagagctgatttccaaagataatgtggtgatagaatctaccaagccagagaatcaagaggcccaggatgggctcaggagcgggtcatctcagctggaagagaccacaagacccaccacctcagctggtatgagccagggaagaaggaagatgtcttgggaggtgcaaccacctcagaggaaaatctgaccaagtcaagccagacagtggaggaagaactgggtaaaataattgaaggatttgtaactggtgcagaagacataatctctggtgccagtcgtatcacgaagtcatgaagacaaaaacacctaaccactaagtcccatgctaggtggtgccttcatcagccacattctgctcatctgaccaccacctctcagtctgccctttgatgtcttacattaaagtattgcaacctaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]