2025-07-06 04:02:47, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001289587 683 bp mRNA linear ROD 07-FEB-2025 DEFINITION Mus musculus glycosylation dependent cell adhesion molecule 1 (Glycam1), transcript variant 1, mRNA. ACCESSION NM_001289587 VERSION NM_001289587.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 683) AUTHORS Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A., Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R., Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J., Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z., Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J., Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L., Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J., Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B., Jackson,S.P. and Balmus,G. CONSRTM Sanger Mouse Genetics Project TITLE Genetic determinants of micronucleus formation in vivo JOURNAL Nature 627 (8002), 130-136 (2024) PUBMED 38355793 REFERENCE 2 (bases 1 to 683) AUTHORS Dill-Garlow,R., Chen,K.E. and Walker,A.M. TITLE Sex Differences in Mouse Popliteal Lymph Nodes JOURNAL Sci Rep 9 (1), 965 (2019) PUBMED 30700819 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 683) AUTHORS Sundberg,J.P., Dadras,S.S., Silva,K.A., Kennedy,V.E., Garland,G., Murray,S.A., Sundberg,B.A., Schofield,P.N. and Pratt,C.H. TITLE Systematic screening for skin, hair, and nail abnormalities in a large-scale knockout mouse program JOURNAL PLoS One 12 (7), e0180682 (2017) PUBMED 28700664 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 683) AUTHORS Williams,P.A., Braine,C.E., Foxworth,N.E., Cochran,K.E. and John,S.W.M. TITLE GlyCAM1 negatively regulates monocyte entry into the optic nerve head and contributes to radiation-based protection in glaucoma JOURNAL J Neuroinflammation 14 (1), 93 (2017) PUBMED 28446179 REMARK GeneRIF: GlyCam1 levels modulate immune cell entry from the vasculature into neural tissues. Publication Status: Online-Only REFERENCE 5 (bases 1 to 683) AUTHORS Dickinson,M.E., Flenniken,A.M., Ji,X., Teboul,L., Wong,M.D., White,J.K., Meehan,T.F., Weninger,W.J., Westerberg,H., Adissu,H., Baker,C.N., Bower,L., Brown,J.M., Caddle,L.B., Chiani,F., Clary,D., Cleak,J., Daly,M.J., Denegre,J.M., Doe,B., Dolan,M.E., Edie,S.M., Fuchs,H., Gailus-Durner,V., Galli,A., Gambadoro,A., Gallegos,J., Guo,S., Horner,N.R., Hsu,C.W., Johnson,S.J., Kalaga,S., Keith,L.C., Lanoue,L., Lawson,T.N., Lek,M., Mark,M., Marschall,S., Mason,J., McElwee,M.L., Newbigging,S., Nutter,L.M., Peterson,K.A., Ramirez-Solis,R., Rowland,D.J., Ryder,E., Samocha,K.E., Seavitt,J.R., Selloum,M., Szoke-Kovacs,Z., Tamura,M., Trainor,A.G., Tudose,I., Wakana,S., Warren,J., Wendling,O., West,D.B., Wong,L., Yoshiki,A., MacArthur,D.G., Tocchini-Valentini,G.P., Gao,X., Flicek,P., Bradley,A., Skarnes,W.C., Justice,M.J., Parkinson,H.E., Moore,M., Wells,S., Braun,R.E., Svenson,K.L., de Angelis,M.H., Herault,Y., Mohun,T., Mallon,A.M., Henkelman,R.M., Brown,S.D., Adams,D.J., Lloyd,K.C., McKerlie,C., Beaudet,A.L., Bucan,M. and Murray,S.A. CONSRTM International Mouse Phenotyping Consortium; Jackson Laboratory; Infrastructure Nationale PHENOMIN, Institut Clinique de la Souris (ICS); Charles River Laboratories; MRC Harwell; Toronto Centre for Phenogenomics; Wellcome Trust Sanger Institute; RIKEN BioResource Center TITLE High-throughput discovery of novel developmental phenotypes JOURNAL Nature 537 (7621), 508-514 (2016) PUBMED 27626380 REMARK Erratum:[Nature. 2017 Nov 16;551(7680):398. doi: 10.1038/nature24643.. PMID: 29144450] REFERENCE 6 (bases 1 to 683) AUTHORS Hemmerich,S., Leffler,H. and Rosen,S.D. TITLE Structure of the O-glycans in GlyCAM-1, an endothelial-derived ligand for L-selectin JOURNAL J Biol Chem 270 (20), 12035-12047 (1995) PUBMED 7538131 REFERENCE 7 (bases 1 to 683) AUTHORS Hemmerich,S., Bertozzi,C.R., Leffler,H. and Rosen,S.D. TITLE Identification of the sulfated monosaccharides of GlyCAM-1, an endothelial-derived ligand for L-selectin JOURNAL Biochemistry 33 (16), 4820-4829 (1994) PUBMED 7512827 REFERENCE 8 (bases 1 to 683) AUTHORS Lasky,L.A., Singer,M.S., Dowbenko,D., Imai,Y., Henzel,W.J., Grimley,C., Fennie,C., Gillett,N., Watson,S.R. and Rosen,S.D. TITLE An endothelial ligand for L-selectin is a novel mucin-like molecule JOURNAL Cell 69 (6), 927-938 (1992) PUBMED 1376638 REFERENCE 9 (bases 1 to 683) AUTHORS Kawamura,K., Satow,H., Do Ik,L., Sakai,S., Takada,S. and Obinata,M. TITLE Modulation of the transferred mouse 26K casein gene in mouse L cells by glucocorticoid hormone JOURNAL J Biochem 101 (1), 103-110 (1987) PUBMED 3571195 REFERENCE 10 (bases 1 to 683) AUTHORS Satow,H., Sakai,S. and Obinata,M. TITLE Post-transcriptional control of 26 k casein genes during lactogenesis in mouse mammary glands JOURNAL J Biochem 99 (6), 1639-1643 (1986) PUBMED 3745138 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC108858.16 and BE947771.1. Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1). Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AW212743.1, BF122403.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849375 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-114 AC108858.16 93487-93600 115-159 AC108858.16 94327-94371 160-413 AC108858.16 95110-95363 414-502 AC108858.16 95554-95642 503-683 BE947771.1 1-181 c FEATURES Location/Qualifiers source 1..683 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="15" /map="15 59.03 cM" gene 1..683 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="glycosylation dependent cell adhesion molecule 1" /db_xref="GeneID:14663" /db_xref="MGI:MGI:95759" exon 1..114 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /inference="alignment:Splign:2.1.0" misc_feature 30..32 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="upstream in-frame stop codon" CDS 51..437 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="isoform 1 precursor is encoded by transcript variant 1; sulfated 50 kDa glycoprotein; endothelial ligand FOR L-selectin; Sele ligand; GlyCAM 1; Glycosylation-dependent cell adhesion molecule 1" /codon_start=1 /product="glycosylation-dependent cell adhesion molecule 1 isoform 1 precursor" /protein_id="NP_001276516.1" /db_xref="CCDS:CCDS88862.1" /db_xref="GeneID:14663" /db_xref="MGI:MGI:95759" /translation="
MKFFTVLLFVSLAATSLALLPGSKDELQMKTQPTDAIPAAQSTPTSYTSEESTSSKDLSKEPSIFREELISKDNVVIESTKPENQEAQDGLRSGSSQLEETTRPTTSAGMSQGRRKMSWEVQPPQRKI"
sig_peptide 51..107 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="/evidence=ECO:0000269|PubMed:1376638; propagated from UniProtKB/Swiss-Prot (Q02596.1)" misc_feature 108..>374 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="Glycosylation-dependent cell adhesion molecule 1 (GlyCAM-1); Region: GLYCAM-1; pfam05242" /db_xref="CDD:368355" misc_feature 210..212 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:P80195; propagated from UniProtKB/Swiss-Prot (Q02596.1); phosphorylation site" misc_feature 225..227 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:P80195; propagated from UniProtKB/Swiss-Prot (Q02596.1); phosphorylation site" misc_feature 237..239 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:P80195; propagated from UniProtKB/Swiss-Prot (Q02596.1); phosphorylation site" misc_feature 261..263 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:P80195; propagated from UniProtKB/Swiss-Prot (Q02596.1); phosphorylation site" exon 115..159 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /inference="alignment:Splign:2.1.0" exon 160..413 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /inference="alignment:Splign:2.1.0" exon 414..669 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /inference="alignment:Splign:2.1.0" regulatory 649..654 /regulatory_class="polyA_signal_sequence" /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="hexamer: ATTAAA" polyA_site 669 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="major polyA site" ORIGIN
agcattctactctgcttcccagggaaagctgaccttgttccagtgccaccatgaaattcttcactgtcctgctatttgtcagtcttgctgccacctctcttgctctcctgcctgggtccaaagatgaacttcaaatgaagactcagcccacagatgccattccagctgcccagtccactcccaccagctacaccagtgaggagagtacttccagtaaggacctttccaaggagccttccatcttcagagaagagctgatttccaaagataatgtggtgatagaatctaccaagccagagaatcaagaggcccaggatgggctcaggagcgggtcatctcagctggaagagaccacaagacccaccacctcagctggtatgagccagggaagaaggaagatgtcttgggaggtgcaaccacctcagaggaaaatctgaccaagtcaagccagacagtggaggaagaactgggtaaaataattgaaggatttgtaactggtgcagaagacataatctctggtgccagtcgtatcacgaagtcatgaagacaaaaacacctaaccactaagtcccatgctaggtggtgccttcatcagccacattctgctcatctgaccaccacctctcagtctgccctttgatgtcttacattaaagtattgcaacctaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]