ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-23 09:26:06, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001289587 683 bp mRNA linear ROD 28-APR-2025
DEFINITION Mus musculus glycosylation dependent cell adhesion molecule 1
(Glycam1), transcript variant 1, mRNA.
ACCESSION NM_001289587
VERSION NM_001289587.1
KEYWORDS RefSeq.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 683)
AUTHORS Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
Jackson,S.P. and Balmus,G.
CONSRTM Sanger Mouse Genetics Project
TITLE Genetic determinants of micronucleus formation in vivo
JOURNAL Nature 627 (8002), 130-136 (2024)
PUBMED 38355793
REFERENCE 2 (bases 1 to 683)
AUTHORS Dill-Garlow,R., Chen,K.E. and Walker,A.M.
TITLE Sex Differences in Mouse Popliteal Lymph Nodes
JOURNAL Sci Rep 9 (1), 965 (2019)
PUBMED 30700819
REMARK Publication Status: Online-Only
REFERENCE 3 (bases 1 to 683)
AUTHORS Sundberg,J.P., Dadras,S.S., Silva,K.A., Kennedy,V.E., Garland,G.,
Murray,S.A., Sundberg,B.A., Schofield,P.N. and Pratt,C.H.
TITLE Systematic screening for skin, hair, and nail abnormalities in a
large-scale knockout mouse program
JOURNAL PLoS One 12 (7), e0180682 (2017)
PUBMED 28700664
REMARK Publication Status: Online-Only
REFERENCE 4 (bases 1 to 683)
AUTHORS Williams,P.A., Braine,C.E., Foxworth,N.E., Cochran,K.E. and
John,S.W.M.
TITLE GlyCAM1 negatively regulates monocyte entry into the optic nerve
head and contributes to radiation-based protection in glaucoma
JOURNAL J Neuroinflammation 14 (1), 93 (2017)
PUBMED 28446179
REMARK GeneRIF: GlyCam1 levels modulate immune cell entry from the
vasculature into neural tissues.
Publication Status: Online-Only
REFERENCE 5 (bases 1 to 683)
AUTHORS Dickinson,M.E., Flenniken,A.M., Ji,X., Teboul,L., Wong,M.D.,
White,J.K., Meehan,T.F., Weninger,W.J., Westerberg,H., Adissu,H.,
Baker,C.N., Bower,L., Brown,J.M., Caddle,L.B., Chiani,F., Clary,D.,
Cleak,J., Daly,M.J., Denegre,J.M., Doe,B., Dolan,M.E., Edie,S.M.,
Fuchs,H., Gailus-Durner,V., Galli,A., Gambadoro,A., Gallegos,J.,
Guo,S., Horner,N.R., Hsu,C.W., Johnson,S.J., Kalaga,S., Keith,L.C.,
Lanoue,L., Lawson,T.N., Lek,M., Mark,M., Marschall,S., Mason,J.,
McElwee,M.L., Newbigging,S., Nutter,L.M., Peterson,K.A.,
Ramirez-Solis,R., Rowland,D.J., Ryder,E., Samocha,K.E.,
Seavitt,J.R., Selloum,M., Szoke-Kovacs,Z., Tamura,M., Trainor,A.G.,
Tudose,I., Wakana,S., Warren,J., Wendling,O., West,D.B., Wong,L.,
Yoshiki,A., MacArthur,D.G., Tocchini-Valentini,G.P., Gao,X.,
Flicek,P., Bradley,A., Skarnes,W.C., Justice,M.J., Parkinson,H.E.,
Moore,M., Wells,S., Braun,R.E., Svenson,K.L., de Angelis,M.H.,
Herault,Y., Mohun,T., Mallon,A.M., Henkelman,R.M., Brown,S.D.,
Adams,D.J., Lloyd,K.C., McKerlie,C., Beaudet,A.L., Bucan,M. and
Murray,S.A.
CONSRTM International Mouse Phenotyping Consortium; Jackson Laboratory;
Infrastructure Nationale PHENOMIN, Institut Clinique de la Souris
(ICS); Charles River Laboratories; MRC Harwell; Toronto Centre for
Phenogenomics; Wellcome Trust Sanger Institute; RIKEN BioResource
Center
TITLE High-throughput discovery of novel developmental phenotypes
JOURNAL Nature 537 (7621), 508-514 (2016)
PUBMED 27626380
REMARK Erratum:[Nature. 2017 Nov 16;551(7680):398. doi:
10.1038/nature24643. PMID: 29144450]
REFERENCE 6 (bases 1 to 683)
AUTHORS Hemmerich,S., Leffler,H. and Rosen,S.D.
TITLE Structure of the O-glycans in GlyCAM-1, an endothelial-derived
ligand for L-selectin
JOURNAL J Biol Chem 270 (20), 12035-12047 (1995)
PUBMED 7538131
REFERENCE 7 (bases 1 to 683)
AUTHORS Hemmerich,S., Bertozzi,C.R., Leffler,H. and Rosen,S.D.
TITLE Identification of the sulfated monosaccharides of GlyCAM-1, an
endothelial-derived ligand for L-selectin
JOURNAL Biochemistry 33 (16), 4820-4829 (1994)
PUBMED 7512827
REFERENCE 8 (bases 1 to 683)
AUTHORS Lasky,L.A., Singer,M.S., Dowbenko,D., Imai,Y., Henzel,W.J.,
Grimley,C., Fennie,C., Gillett,N., Watson,S.R. and Rosen,S.D.
TITLE An endothelial ligand for L-selectin is a novel mucin-like molecule
JOURNAL Cell 69 (6), 927-938 (1992)
PUBMED 1376638
REFERENCE 9 (bases 1 to 683)
AUTHORS Kawamura,K., Satow,H., Do Ik,L., Sakai,S., Takada,S. and Obinata,M.
TITLE Modulation of the transferred mouse 26K casein gene in mouse L
cells by glucocorticoid hormone
JOURNAL J Biochem 101 (1), 103-110 (1987)
PUBMED 3571195
REFERENCE 10 (bases 1 to 683)
AUTHORS Satow,H., Sakai,S. and Obinata,M.
TITLE Post-transcriptional control of 26 k casein genes during
lactogenesis in mouse mammary glands
JOURNAL J Biochem 99 (6), 1639-1643 (1986)
PUBMED 3745138
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AC108858.16 and BE947771.1.
Transcript Variant: This variant (1) represents the longer
transcript and encodes the longer isoform (1).
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AW212743.1, BF122403.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN00849375 [ECO:0000348]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-114 AC108858.16 93487-93600
115-159 AC108858.16 94327-94371
160-413 AC108858.16 95110-95363
414-502 AC108858.16 95554-95642
503-683 BE947771.1 1-181 c
FEATURES Location/Qualifiers
source 1..683
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6"
/db_xref="taxon:10090"
/chromosome="15"
/map="15 59.03 cM"
gene 1..683
/gene="Glycam1"
/gene_synonym="glyCAM-1; MC26; Sgp50"
/note="glycosylation dependent cell adhesion molecule 1"
/db_xref="GeneID:14663"
/db_xref="MGI:MGI:95759"
exon 1..114
/gene="Glycam1"
/gene_synonym="glyCAM-1; MC26; Sgp50"
/inference="alignment:Splign:2.1.0"
misc_feature 30..32
/gene="Glycam1"
/gene_synonym="glyCAM-1; MC26; Sgp50"
/note="upstream in-frame stop codon"
CDS 51..437
/gene="Glycam1"
/gene_synonym="glyCAM-1; MC26; Sgp50"
/note="isoform 1 precursor is encoded by transcript
variant 1; sulfated 50 kDa glycoprotein; endothelial
ligand FOR L-selectin; Sele ligand; GlyCAM 1;
Glycosylation-dependent cell adhesion molecule 1"
/codon_start=1
/product="glycosylation-dependent cell adhesion molecule 1
isoform 1 precursor"
/protein_id="NP_001276516.1"
/db_xref="CCDS:CCDS88862.1"
/db_xref="GeneID:14663"
/db_xref="MGI:MGI:95759"
/translation="
MKFFTVLLFVSLAATSLALLPGSKDELQMKTQPTDAIPAAQSTPTSYTSEESTSSKDLSKEPSIFREELISKDNVVIESTKPENQEAQDGLRSGSSQLEETTRPTTSAGMSQGRRKMSWEVQPPQRKI"
sig_peptide 51..107
/gene="Glycam1"
/gene_synonym="glyCAM-1; MC26; Sgp50"
/note="/evidence=ECO:0000269|PubMed:1376638; propagated
from UniProtKB/Swiss-Prot (Q02596.1)"
misc_feature 108..>374
/gene="Glycam1"
/gene_synonym="glyCAM-1; MC26; Sgp50"
/note="Glycosylation-dependent cell adhesion molecule 1
(GlyCAM-1); Region: GLYCAM-1; pfam05242"
/db_xref="CDD:368355"
misc_feature 210..212
/gene="Glycam1"
/gene_synonym="glyCAM-1; MC26; Sgp50"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P80195; propagated from
UniProtKB/Swiss-Prot (Q02596.1); phosphorylation site"
misc_feature 225..227
/gene="Glycam1"
/gene_synonym="glyCAM-1; MC26; Sgp50"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P80195; propagated from
UniProtKB/Swiss-Prot (Q02596.1); phosphorylation site"
misc_feature 237..239
/gene="Glycam1"
/gene_synonym="glyCAM-1; MC26; Sgp50"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P80195; propagated from
UniProtKB/Swiss-Prot (Q02596.1); phosphorylation site"
misc_feature 261..263
/gene="Glycam1"
/gene_synonym="glyCAM-1; MC26; Sgp50"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P80195; propagated from
UniProtKB/Swiss-Prot (Q02596.1); phosphorylation site"
exon 115..159
/gene="Glycam1"
/gene_synonym="glyCAM-1; MC26; Sgp50"
/inference="alignment:Splign:2.1.0"
exon 160..413
/gene="Glycam1"
/gene_synonym="glyCAM-1; MC26; Sgp50"
/inference="alignment:Splign:2.1.0"
exon 414..669
/gene="Glycam1"
/gene_synonym="glyCAM-1; MC26; Sgp50"
/inference="alignment:Splign:2.1.0"
regulatory 649..654
/regulatory_class="polyA_signal_sequence"
/gene="Glycam1"
/gene_synonym="glyCAM-1; MC26; Sgp50"
/note="hexamer: ATTAAA"
polyA_site 669
/gene="Glycam1"
/gene_synonym="glyCAM-1; MC26; Sgp50"
/note="major polyA site"
ORIGIN
agcattctactctgcttcccagggaaagctgaccttgttccagtgccaccatgaaattcttcactgtcctgctatttgtcagtcttgctgccacctctcttgctctcctgcctgggtccaaagatgaacttcaaatgaagactcagcccacagatgccattccagctgcccagtccactcccaccagctacaccagtgaggagagtacttccagtaaggacctttccaaggagccttccatcttcagagaagagctgatttccaaagataatgtggtgatagaatctaccaagccagagaatcaagaggcccaggatgggctcaggagcgggtcatctcagctggaagagaccacaagacccaccacctcagctggtatgagccagggaagaaggaagatgtcttgggaggtgcaaccacctcagaggaaaatctgaccaagtcaagccagacagtggaggaagaactgggtaaaataattgaaggatttgtaactggtgcagaagacataatctctggtgccagtcgtatcacgaagtcatgaagacaaaaacacctaaccactaagtcccatgctaggtggtgccttcatcagccacattctgctcatctgaccaccacctctcagtctgccctttgatgtcttacattaaagtattgcaacctaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]