2024-09-28 11:21:39, GGRNA.v2 : RefSeq release 225 (Jul, 2024)
LOCUS NM_001285898 2161 bp mRNA linear ROD 05-AUG-2023 DEFINITION Mus musculus calreticulin 4 (Calr4), transcript variant 5, mRNA. ACCESSION NM_001285898 VERSION NM_001285898.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 2161) AUTHORS Diaz Del Moral S, Barrena S, Hernandez-Torres F, Aranega A, Villaescusa JM, Gomez Doblas JJ, Franco D, Jimenez-Navarro M, Munoz-Chapuli R and Carmona R. TITLE Deletion of the Wilms' Tumor Suppressor Gene in the Cardiac Troponin-T Lineage Reveals Novel Functions of WT1 in Heart Development JOURNAL Front Cell Dev Biol 9, 683861 (2021) PUBMED 34368133 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 2161) AUTHORS Ansarullah, Jain C, Far FF, Homberg S, Wissmiller K, von Hahn FG, Raducanu A, Schirge S, Sterr M, Bilekova S, Siehler J, Wiener J, Oppenlander L, Morshedi A, Bastidas-Ponce A, Collden G, Irmler M, Beckers J, Feuchtinger A, Grzybek M, Ahlbrecht C, Feederle R, Plettenburg O, Muller TD, Meier M, Tschop MH, Coskun U and Lickert H. TITLE Inceptor counteracts insulin signalling in beta-cells to control glycaemia JOURNAL Nature 590 (7845), 326-331 (2021) PUBMED 33505018 REMARK Erratum:[Nature. 2021 Apr;592(7852):E1. PMID: 33712809] REFERENCE 3 (bases 1 to 2161) AUTHORS Dey S and Matsunami H. TITLE Calreticulin chaperones regulate functional expression of vomeronasal type 2 pheromone receptors JOURNAL Proc Natl Acad Sci U S A 108 (40), 16651-16656 (2011) PUBMED 21933956 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL627103.13, AK077094.1, AK139540.1 and BG083829.2. Transcript Variant: This variant (5) has alternate 5' exon structure and it thus differs in the 5' UTR and initiates translation at a downstream in-frame start codon, compared to variant 1. The encoded isoform (c) is shorter at the N-terminus, compared to isoform a. Variants 3, 4 and 5 all encode isoform c. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: BC044740.2, SRR1660813.189233.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849384, SAMN01164131 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-371 AL627103.13 87877-88247 372-1758 AK077094.1 212-1598 1759-2141 AK139540.1 1509-1891 2142-2161 BG083829.2 516-535 FEATURES Location/Qualifiers source 1..2161 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="4" /map="4 51.1 cM" gene 1..2161 /gene="Calr4" /gene_synonym="4933403L16Rik" /note="calreticulin 4" /db_xref="GeneID:108802" /db_xref="MGI:MGI:2140435" exon 1..371 /gene="Calr4" /gene_synonym="4933403L16Rik" /inference="alignment:Splign:2.1.0" misc_feature 335..337 /gene="Calr4" /gene_synonym="4933403L16Rik" /note="upstream in-frame stop codon" exon 372..473 /gene="Calr4" /gene_synonym="4933403L16Rik" /inference="alignment:Splign:2.1.0" exon 474..677 /gene="Calr4" /gene_synonym="4933403L16Rik" /inference="alignment:Splign:2.1.0" CDS 644..1585 /gene="Calr4" /gene_synonym="4933403L16Rik" /note="isoform c is encoded by transcript variant 5" /codon_start=1 /product="calreticulin 4 isoform c" /protein_id="NP_001272827.1" /db_xref="CCDS:CCDS71441.1" /db_xref="GeneID:108802" /db_xref="MGI:MGI:2140435" /translation="
MHSESQYYIMFGPDICGFGNNRLQVILSHKGKYHENNKTLKCRINKDTHLYTLILRPNATYEVKIDNQKVTSGGLEDDWDFLPPKKIKDPYARKPRKWDERQQIEDPDDKKPEDWEDSEFIPDPDAKKPDDWNEAMDGVWEGPLIPNVKYMGEWKPRIIDNPNYQGEWIHPEIDNPKYRPDPTIGHYHNISVLGLDLWQVKSGSIFDNFLLTNDEEFAEEVGNMTWGLRKDVEQQWRELYEEMEKQKEAEETKKKREKERARQEDVWGLDEEDEEDAEEDDEEEAEERLKQEGSAARASLDQKEAHLDQKDEL"
misc_feature <644..1276 /gene="Calr4" /gene_synonym="4933403L16Rik" /note="Calreticulin family; Region: Calreticulin; pfam00262" /db_xref="CDD:459737" exon 678..772 /gene="Calr4" /gene_synonym="4933403L16Rik" /inference="alignment:Splign:2.1.0" exon 773..982 /gene="Calr4" /gene_synonym="4933403L16Rik" /inference="alignment:Splign:2.1.0" exon 983..1096 /gene="Calr4" /gene_synonym="4933403L16Rik" /inference="alignment:Splign:2.1.0" exon 1097..1240 /gene="Calr4" /gene_synonym="4933403L16Rik" /inference="alignment:Splign:2.1.0" exon 1241..1333 /gene="Calr4" /gene_synonym="4933403L16Rik" /inference="alignment:Splign:2.1.0" exon 1334..2161 /gene="Calr4" /gene_synonym="4933403L16Rik" /inference="alignment:Splign:2.1.0" ORIGIN
gtcgaaaactgcaagggagagtccatagagtttaagcaacagaaaggggccaggagaaattgattgttcgtgataatcattactaatttaaggagtttgaaatgttttgctagtctcttccctgagggagcaggttttactattttacttcacaaagcataagtgtgtgcaagggcttagtcctcaggggcttattttccatctacttttgtgactatagcgcttcttgccctacaaccgcaccctcccaatggcagttttcaggacttaacccccgcgaatgcagtgttggtggaaaagtggctcaggtgcttggcatttgagcagctcctcctgacaggacataaatagtgggttccaggtactgtgtgatggatggacaaaacggtgggtacaatctaaacatcagtcagattacggccaattccagctagcctcgggaaaattttatcaagataaagagagagataaaggtctccagaccacagaagatgccaagttctacgccctttccaccaggtttaagccattcagcaatgagaatgagaccttggtggttcagttttcagtaaaacacgagcaaggcatcgattgcggcggtggctacgtgaaactctttcctgccgcactgaaccaggaggacatgcactcagaatcccagtattacatcatgttcggcccggacatctgtggctttggcaacaacagactacaggtcatcctttctcacaaagggaaataccatgagaacaacaagaccctcaagtgcaggattaataaagacactcacctgtacactctgatccttcgccctaatgctacttatgaggttaaaattgacaaccagaaggtgacaagtggaggactggaagatgactgggacttcttgcctcccaagaaaataaaagacccctacgccaggaaaccaaggaaatgggatgaacgacaacagatagaggatcctgacgataagaaacctgaggactgggaggactctgaattcatcccagacccggatgccaagaagccagatgactggaatgaggcgatggatggagtgtgggaagggcccttgataccaaacgtcaagtacatgggagaatggaaacctcggatcattgacaaccccaattaccagggcgagtggattcacccagagatagacaaccccaaatacaggcctgaccccaccattggtcactatcacaacattagtgtccttggtctggatctttggcaggtgaaatcaggcagcatctttgacaatttccttctaacaaatgatgaagagtttgctgaagaggttggaaatatgacctggggattaagaaaggatgtggagcagcagtggagagagctgtatgaggaaatggagaaacagaaggaggcggaggagaccaagaagaagagggaaaaggagagagccaggcaagaggacgtctggggactagatgaggaggatgaggaggacgctgaagaggacgacgaggaggaagcagaggaaaggctcaagcaggaaggcagtgcagcgagggcgtctctggaccagaaggaagcccacttggatcagaaggatgaactgtaactgcacagacactgggtgtggccgaagtcagagacggtgcttagagagggaaatgggccctcgcttagcaaattatgggaagtaaaacgactcattctttttagataaactttggatttatagttctactccccttccctgctctatttgctcattggtagaaagggaatgataattttatctcatgaaatggcccttgggactgaatgaggcaatgcctgtaacatgcccaaagtaaatacttgtaaaaaaaatgtagtagttaaaactactatcattatcatggtgtttatgaaattaattgttggtaaataagcttctatataaacttggttcttactttcaactggggtttttcttttgtttaaatatatgcaattcttagtatttatggagcagtgctaacagttgaacccaatgtttccttttttttttttttttttaaatgtattgagcacctaaagccaaaagcagaacatcctttggacgtttggaaaaatacttcatgaaagtcaccttgtttgcctgctgctcttgccttatgtttaaacaattgttacttgtttgcaagtttgc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]